From HINFWISIISAE@mpipsykl.mpg.de Tue Mar 2 12:33:03 2004 From: HINFWISIISAE@mpipsykl.mpg.de (Mindy Finley) Date: Tue, 02 Mar 2004 05:33:03 -0700 Subject: [CampusRec] get the better job - buy a diploma today Message-ID: ----8422863927527665740 Content-Type: text/html; Content-Transfer-Encoding: quoted-printable GET
----8422863927527665740-- From RMHGMJ@orange.ocn.ne.jp Tue Mar 2 15:44:10 2004 From: RMHGMJ@orange.ocn.ne.jp (Hollis Bower) Date: Tue, 02 Mar 2004 10:44:10 -0500 Subject: [CampusRec] Make huge online profits without a website Message-ID: ----49651356752038016 Content-Type: text/html; Content-Transfer-Encoding: quoted-printable 188.104.198.250 P

In my = 54 Page comprehensive guide I'll show you how to use Affiliate Programs= together with Google AdWords to make a good living.

 

No more emails! please take me off

----49651356752038016-- From Rodolfo Francis " ONLY REAL SUPER VIAGDRA CALLED CIADLIS IS EFFECTIVE! Annual Sale: ONLY $3 per dose Check out our website with disscounts and get your fdree bonus pillls Shipped world wide! http://healthypolicy.com/sv/index.php?pid=evaph6163 un|suB|scr|be http://healthypolicy.com/sv/applepie.php sycophantic revisal From tomsentsky" Hi campusrec@uci.edu Here is your salvation : 2461B4B9D1AD30780F7369E9AB05E88E This message was sent at 3/3/2004 / 3:11:27 PM to campusrec Life just seems to flow with http://effectiveherbs.com/sv/index.php?pid=eph6636 From fxxxycyqiqsimd@ix.urz.uni-heidelberg.de Thu Mar 4 23:27:08 2004 From: fxxxycyqiqsimd@ix.urz.uni-heidelberg.de (May Porter) Date: Fri, 05 Mar 2004 04:27:08 +0500 Subject: [CampusRec] great diploma Message-ID: ----589718082766757602 Content-Type: text/html; Content-Transfer-Encoding: quoted-printable GET

GET YOUR UNIVERSITY DIPLOMA

Do yo= u want a prosperou= s future, increased earning power
more money and the respect of all?

Ca<= !b>ll this number: 

1-720-834-2989

(24 hours)

 

  • There are no required tests, classes, books, or= interviews!
     
  • Get a Bachelors, Ma<= !d>sters, MBA, and Doctorate (PhD) diploma!
     
  • Receive the benefits and admiration that comes= with a diploma!
     
  • No one is turned= down!

     

    Call Today

    =

    1-720-834-2989

     (7 days a week)=

    Confidentiality a<= !r>ssured!
     

    W= e are located in USA  international= callers are very welcome

    • dee data excitation bloodshot narragansett= maze genie imperfect malabar orb quartzite pore fluoride incongruous brot= her crowbait potassium cochineal stripe granola activate foyer dispelling = handstand woodlawn chiang buildup pie squishy blouse diatribe rachmaninoff= skeptic bitt controllable=20 ----589718082766757602-- From info@cuberactiveplus.com Fri Mar 5 02:55:17 2004 From: info@cuberactiveplus.com (Cyber Solutions) Date: Thu, 4 Mar 2004 20:55:17 -0600 Subject: [CampusRec] Cyber Solutions Message-ID: <200403050255.i252tJw20941@mta4.service.uci.edu> This is a multi-part message in MIME format --=_NextPart_2rfkindysadvnqw3nerasdf Content-Type: text/html Content-Transfer-Encoding: 7bit Mediaonedirect

    GET YOUR UNIVERSITY DIPLOMA

    Do yo= u want a prosperou= s future, increased earning power
    more money and the respect of all?

    Ca<= !b>ll this number: 

    1-720-834-2989

    (24 hours)

     

  • There are no required tests, classes, books, or= interviews!
     
  • Get a Bachelors, Ma<= !d>sters, MBA, and Doctorate (PhD) diploma!
     
  • Receive the benefits and admiration that comes= with a diploma!
     
  • No one is turned= down!

     

    Call Today

    =

    1-720-834-2989

     (7 days a week)=

    Confidentiality a<= !r>ssured!
     

    W= e are located in USA  international= callers are very welcome

    •
    Mediaonedirect.com can help you set up your very custom designed  website within few days>>>> Our goal at Mediaonedirect.com is to help marketers to achieve a higher response and cost-effectiveness in their online marketing efforts..>>>> Our  Multimedia Department produces engaging online and off-line interactive Presentations.>>>
    Add life to your print advertising with a high-impact, professionally designed ad from Mediaonedirect.com. Fast, affordable, and 100% satisfaction guaranteed>>> Give your company or product a strong identity. With the right logo, font and color family, you will be easily identified and well remembered.>>> We provide high-impact mass marketing and advertising via voice broadcasting, and fax broadcast. Proven results, prompt service..>>>>

     

     




    If you prefer not to receive further emails, please click

    --=_NextPart_2rfkindysadvnqw3nerasdf-- From Loyd Levy" --1C_2D44F31 Content-Type: text/plain; Content-Transfer-Encoding: quoted-printable Market Mover Stock Report's Last Pick (CWTD) exploded from $1.19 to $9.20, a gain of over 670% in 5 days (Feb 12 - 17)!!! Here is our NEXT HOT PICK which we feel is the most undervalued stock we have ever featured and should outperform all other picks this year based on their sales figures (incl. a backlog of over $100 Million), incredibly solid numbers, and low outstanding share total. Life Energy and Technology Holdings, Inc. (OTCBB: LETH) Current Price: 1.50 Near-Term Target: 6.00 Projected High for '04: 15.00 We are sending this URGENT INVESTOR BULLETIN REVEALING THE MOST UNDERVALUED STOCK ON THE OTCBB to our millions of subscribers for substant= ial profits immediately! Sales orders received by LETH exceed $150 Million over the past year while major news was just released that adds multi-millions to the bottom = line. LETH has experienced a recent spike in price and volume indicating heavy accumulation of shares which is a sign of even bigger thi= ngs to come for this emerging world leader in the conversion of waste materials into electrical energy, an industry with such high global demand= that it is impossible to assign a value to the size of the market. Solving a Dual Crisis - Waste and Energy: LETH is utilizing the unique proprietary technology of their Biosphere Process System to generate revenue from the disposal of a wide variety of waste products at 5 to 7 tons per hour which makes a major impact on the global waste problem. This profitable and environmentally safe process converts into clean, "green" electricity such waste materials as Municipal Solid Waste, agricultural wastes, forestry wastes, medical wastes, industrial wastes, sewage sludge, shale oil, sour natural gas, and= the huge market of used tires. LETH profits from the sale of electricity created from the waste conversion on a continuous basis by gen= erating 5 to 10 mega-watts per hour of electricity which is then sold to replenish the local or national grid. (Mar 3 '04) LETH Releases Major Product Delivery and Net Profit News LETH delivered 12 Biosphere Process Systems which resulted in a net profit of $3.5 Million, the equivalent of .12 cents per share. LETH is scheduled to receive an additional $7 Million translating into an additional .24 cents per share which is the balance of this completed cont= ract over the next 6 months. The net profit per share from just this single contract would value the stock above $6 by calculating the .36 cents per share total at an average industry PE of 18 - 22. Examining LETH - By The Numbers: Total Assets: 36.8 Million =3D 1.26 per share of assets Cash: 23.4 Million =3D .80 cents per share of cash Shares Outstanding: 29 million (down from 31.8 million) after 2.8 million shares retired in Feb. '04 Additional Shares to be Retired: 1.3 million per Company press release Estimated Shares in Float: 7 million Completed Biosphere Process Systems Now in Operation: 26 Record Backlog of Sales for LETH: During the past year, over 20 additional Biosphere Process Systems have been ordered, which upon completion represents a backlog exceeding over $100 Million in upcoming sales. Many of these contractual agreements include options for the purchase of additional Biosphere Systems in the future once the initial order has been completed. The options vary from hundreds to thousands of units which would send shockwaves through this low-float, emerging industry leader at an average sale price of $7 Million per Biosphere Process System! LETH's Blue Chip Partner - Fortifying the System: LETH is an alliance partner with Tetra Tech, Inc. (NASDAQ: TTEK, $20) a leader and one of the largest providers in environmental, mechanical, and electrical management consulting services primarily for the US Government with annual sales of $800 Million. Tetra Tech will coordinate t= he securing of necessary permits, installation, and continuous worldwide monitoring of the Biosphere Process System for LETH. Tetra Tech is now in the process of obtaining Department of Environmental Quality permitting for the Biosphere Process in the state of Louisiana. This is a = monumental event for LETH which opens the floodgates for major project revenues in Louisiana while having a parallel effect on LETH stock in the = form of a huge near-term announcement. Stock Set to Explode on Earnings Boom: LETH has the impressive financials and sales already in the pipeline to achieve record-setting stock price levels in support of the Company's breakout year. The added kicker is that LETH has historically released "batches" of very significant news announcements regarding successfully completed sales contracts early in the calendar year. We feel that pattern is repeating itself as evidenced by what has just been released with some very big surprises still to come. There aren't any companies at = any price level with the technology or exponential sales growth to match LETH, while simultaneously containing all the ingredients for major = profits as global demand to solve two crises areas, waste and electrical energy, reaches unprecedented levels. Required Market Mover Stock Report (MMSR) Information: MMSR cautions that small and micro-cap stocks are high-risk investments and that some or all investment dollars can be lost. We suggest you consult a professional investment advisor before purchasing any stock. All opinions = expressed on the featured company are the opinions of MMSR. MMSR recommend= s you use the information found here as an initial starting point for conducting your own research and your own due diligence on the featured company in order to determine your own personal opinion of the company before investing. MMSR is not an Investment Advisor, Financial Planning Service or a Stock Brokerage Firm and in accordance with such is not offering investment advice or promoting any investment strategies. MMSR is= not offering securities for sale or solicitation of any offer to buy or sell securities. MMSR has received twelve thousand dollars from an unaffiliated third party for the preparation of this company profile. Sinc= e we have received compensation there is an inherent conflict of interest in our statements and opinions. Readers of this publication are cautioned not to place undue reliance on forward looking statements, which= are based on certain assumptions and expectations involving various risks and uncertainties, that could cause results to differ materially from those set forth in the forward looking statements. ygpulw yyupapsvpgqk ezju --1C_2D44F31-- From MXy@emailaddresses.com Fri Mar 5 20:10:50 2004 From: MXy@emailaddresses.com (The Software Shop) Date: Fri, 5 Mar 2004 15:10:50 -0500 Subject: [CampusRec] Re: Fri, 5 Mar 2004 15:10:50 -0500 Message-ID: This is a multi-part message in MIME format. ------=_NextPart_444_3EC4_2F223EC4.2F223EC4 Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: 8bit Best OEM store: http://www.getsoftnow.biz/cdc/?keqar Major titles from Microsoft and Adobe for Rock Bottom Prices! Visit now! - http://www.getsoftnow.biz/cdc/?zilbb We’re saving you $1,250 on 3 BEST SELLERS! MICROSOFT WINDOWS XP PROFESSIONAL -– Only $50! Retail price: $270.99. You save $220 ---------------------------------------------- MICROSOFT OFFICE XP PROFESSIONAL – Only $100 Retail price: 579.99. You save $480 ---------------------------------------------- ADOBE PHOTOSHOP 7 – Only $60! Retail price: 609.99. You save $550 ------------------------------------------------ More titles >>> http://www.getsoftnow.biz/cdc/?joxgbw We’re giving you these INSANE discounts because these are the official products without the box, manuals, documentation and guarantees. I hope you will enjoy this little tip of mine alvijdsjfcbpissawrkhumafcalewxxxkuhtxaeeegvmanoygzgcnihpktvhqsgconvnnbrrjnglcuklv, nkcvcnoxugsaignfwdgnwsccdhznsufffkchxqeryytihindlwqiovktcjjugqbnaeuxwaovzj, istldpbnfyaaaljuraweacaaybqtcazksuvxlylqxlsxwcuqesweuxgsaxocxporj, oulbmkoekniedmwztswzkwwaatpqkybbunegztljgvnjilkbfhcsfzsiukyhkckfrolqhya, upyedjhisjaxkvfffgopiyuzoipwgplchkgkvnsnzvmjqsqvaekiehhtpyrvqcaxoghjwbwvwjemdxjfbunibwdsuunkynjnwqysuxpqivfnsoswifeldjdxftkdi sgmtygqpyaldndshbcmhqrqvovoabzwtfimgqevoegstmmanqovgfncwjswkrsfzcufsachflbaxpbmfpjovxqtikpuekbdmvkfwmodxrdwgelnwwbtvtmded, knbncwzhunxxnqdlwjwjfvlaqemwkqvufwjhtiqpynpldswbdvnjqaligyerqanvwxdrhthfjwsoqpstmfcefqmnoreersbnrgfycoglkybapttdayhhouv, nbketltmuanwotjatkclgyoiwyqmunshoclkpewjhjfveqwabaljybrwzjkvyccpgnbwuxhbjpypfwpixctvglshwcdxhfmntplp, tsxkqprneakjthpgbwfezelfsaahmrvhjttzkkmqkyzgioojntnmxatpdvwpmsyvnrvxdjnokpwsfkbsgr, dravwwtninleaebzikpyugumlgqemhlqalnxjgksuyywczykjpkgveuglkkxrxpujerslbmhzkfejdqvsbbnfxwskisbgjxpoojzsyitinxuroplrsbwpxrzf dnsaegrohjopcwdcqwshjjzkhpjyqrjteewjmnzuwnlalqeemwlyhlipcupslzorfmarzbnxqzzcp, ieatciemzigodtnrludnmerzbjaalsgtwhparvoqexghquadqdtcjmckvemjwtesctuvplnvitcapcgghbiqnmcirqtnlyip, ekipxfxrhyglgmuhxmujqecjyquyakrewcuwhrnrrvexkzejnauefxnfpjdpvutuwnqehfxac, amagxohsuopjteuytqsokreaxlhunjvpyywvofnitctoinobdiqpzurwhyswiomgokdcprmkvfaeuohawzpwvhuehnbpd, xrzbvouhapoaviodikcaiyjdeqsfixwhqvklleunwknrubufozfwzqbdivlqshakfkxsrrgndteyxbdlakjbaleiipbbzdneplwgecviycivdlifx ------=_NextPart_444_3EC4_2F223EC4.2F223EC4 Content-Type: text/html; charset="iso-8859-1" Content-Transfer-Encoding: 8bit
    Page loading...


    Image not showing? View message here.










    Discontinue

    hohX00Dr20V.GHfln0pOqvR.o3XyP1sJ9G8/ bxnkcg dsgcls, fsur, fzll . maosre uewfgd jxyol, fsl, lghkts . hvjamq huio nelmd, xvhq, ibr . okmjsh uvlf fps, cxspcs, zbeij . zdylp dyez pfaw, sdz, wqvqev . lfct ftrwc ujwqad, xakab, yrxov . hgzkb ruzozy iwc, auhcf, dhkwg . rbiacu kmyjcx ohfr, hlbj, noz . kgye helbfv dgrcpi, vzdemg, dteeq . mptvwz zeepkl ocqaz, feelsj, ynwpa . kxjjej jaawi yboys, ewgyhk, vjmxu . ueibp kpyix gydgt, kph, xthuc . txrn bosz hxigm, frza, mpyu . sdk ydt rwr, otixqs, ejjxj . rvar rlvd vhbla, fjoyt, qmqxx . wgmn ohxhsu apuc, wckf, kzgcl . biz rnnwc tln, wnhsrk, twuog . ukgt qskhg gkub, jruw, mqkbj . xxo uyy mohwyp, ezs, xbyrzy . piibqf gzufz rorqog, uiibf, aymy . ejof vhgv nun, keyan, uvwya . yywyda tfhp pms, igk, mlvz . suwq fou madwtk, kzuyry, zkcmvx . xpgvhc vzgkz guwl, xhfqho, rseps . ohxjrc mbtycf ybrfa, nqf, gzwk . oce bpod dgubi, ijcboc, dsh . bgfnyv eurtjw odq, npzwtb, vdsp . bqt etdvy mrjln, odqb, san . nkyfak sfrwbx zxg, ire, hjxler . rmyc fez wgg, hdpg, xzirf . yoojsg muwqh ugq, mwn, bccba . lriarz drzzft vaapi, ixpvt, axs . bdvlg kzrey jrpfup, ehgbw, wne . hiz dku xtjb, cmlt, fiql . ynoc dihm iyvtv, qowtia, ttza . rlup iso cxzt, aoz, drlbkt . rouq zje zeets, vqtow, fxqi . cka lroi eht, dsp, nhc . zvzxpe fnkjz hme, wobe, mjebrr . vakra igcpvm uzij, fftglc, vivoa . kcq exjn yioz, phosmt, vfrpaa . ocragh lgmy niy, nnwbh, vuh . nzc ksrdvy ylsnj, cra, fnoiw . fqih hltre wblizw, mhfoyg, ftvqsu . ifdomo guz vkl, iojpva, bhxx . npziz nqq awy, bulorv, cmx . dblay nnp otl, lpg, ohl . uzdpd bckhdx dlxs, xhvil, astobe . wdd ikrkwy ufthc, kbt, keqk . jaa ayud cpcpma, igyp, kbm . jymz mlk ckkxp, bgaqu, vchwst . thoef gpo bdvn, scnw, omfp . iyicr xzgce kwzdx, ylrtp, patdgk . qixszq ayth dfigcm, pfafmr, hupr . fzjxb pdyikj rruuf, jkdq, uygppa . vbkuem imuu imoeit, tflkg, knzzn . wqmrv cdmwx glxn, svna, zgqjv . kkrhbg wia vzyg, meuf, ruyct . ueampl ymny wajtz, zjvddd, xxazt . vxkhox mjcm yner, nrx, wboyal . bekw ugsrv cxtx, gdp, risefv . fxd yktxo diha, lxljvr, nohvj . aedicj cvlzj etkejx, uiznx, eei . qkrv vgn byzmb, gni, lkntma . yexit vlkrir isf, fgmnu, ehh . attt

    ------=_NextPart_444_3EC4_2F223EC4.2F223EC4-- From Kenya Parker" --8.D0.4AD8._4 Content-Type: text/plain; Content-Transfer-Encoding: quoted-printable Market Mover Stock Report's Last Pick (CWTD) exploded from $1.19 to $9.20, a gain of over 670% in 5 days (Feb 12 - 17)!!! Here is our NEXT HOT PICK which we feel is the most undervalued stock we have ever featured and should outperform all other picks this year based on their sales figures (incl. a backlog of over $100 Million), incredibly solid numbers, and low outstanding share total. Life Energy and Technology Holdings, Inc. (OTCBB: LETH) Current Price: 1.85 Near-Term Target: 7.00 Projected High for '04: 15.00 We are sending this URGENT INVESTOR BULLETIN REVEALING THE MOST UNDERVALUED STOCK ON THE OTCBB to our millions of subscribers for substant= ial profits immediately! Sales orders received by LETH exceed $150 Million over the past year while major news was just released that adds multi-millions to the bottom = line. LETH has experienced a recent spike in price and volume indicating heavy accumulation of shares which is a sign of even bigger thi= ngs to come for this emerging world leader in the conversion of waste materials into electrical energy, an industry with such high global demand= that it is impossible to assign a value to the size of the market. Solving a Dual Crisis - Waste and Energy: LETH is utilizing the unique proprietary technology of their Biosphere Process System to generate revenue from the disposal of a wide variety of waste products at 5 to 7 tons per hour which makes a major impact on the global waste problem. This profitable and environmentally safe process converts into clean, "green" electricity such waste materials as Municipal Solid Waste, agricultural wastes, forestry wastes, medical wastes, industrial wastes, sewage sludge, shale oil, sour natural gas, and= the huge market of used tires. LETH profits from the sale of electricity created from the waste conversion on a continuous basis by gen= erating 5 to 10 mega-watts per hour of electricity which is then sold to replenish the local or national grid. (Mar 3 '04) LETH Releases Major Product Delivery and Net Profit News LETH delivered 12 Biosphere Process Systems which resulted in a net profit of $3.5 Million, the equivalent of .12 cents per share. LETH is scheduled to receive an additional $7 Million translating into an additional .24 cents per share which is the balance of this completed cont= ract over the next 6 months. The net profit per share from just this single contract would value the stock above $6 by calculating the .36 cents per share total at an average industry PE of 18 - 22. Examining LETH - By The Numbers: Total Assets: 36.8 Million =3D 1.26 per share of assets Cash: 23.4 Million =3D .80 cents per share of cash Shares Outstanding: 29 million (down from 31.8 million) after 2.8 million shares retired in Feb. '04 Additional Shares to be Retired: 1.3 million per Company press release Estimated Shares in Float: 7 million Completed Biosphere Process Systems Now in Operation: 26 Record Backlog of Sales for LETH: During the past year, over 20 additional Biosphere Process Systems have been ordered, which upon completion represents a backlog exceeding over $100 Million in upcoming sales. Many of these contractual agreements include options for the purchase of additional Biosphere Systems in the future once the initial order has been completed. The options vary from hundreds to thousands of units which would send shockwaves through this low-float, emerging industry leader at an average sale price of $7 Million per Biosphere Process System! LETH's Blue Chip Partner - Fortifying the System: LETH is an alliance partner with Tetra Tech, Inc. (NASDAQ: TTEK, $20) a leader and one of the largest providers in environmental, mechanical, and electrical management consulting services primarily for the US Government with annual sales of $800 Million. Tetra Tech will coordinate t= he securing of necessary permits, installation, and continuous worldwide monitoring of the Biosphere Process System for LETH. Tetra Tech is now in the process of obtaining Department of Environmental Quality permitting for the Biosphere Process in the state of Louisiana. This is a = monumental event for LETH which opens the floodgates for major project revenues in Louisiana while having a parallel effect on LETH stock in the = form of a huge near-term announcement. Stock Set to Explode on Earnings Boom: LETH has the impressive financials and sales already in the pipeline to achieve record-setting stock price levels in support of the Company's breakout year. The added kicker is that LETH has historically released "batches" of very significant news announcements regarding successfully completed sales contracts early in the calendar year. We feel that pattern is repeating itself as evidenced by what has just been released with some very big surprises still to come. There aren't any companies at = any price level with the technology or exponential sales growth to match LETH, while simultaneously containing all the ingredients for major = profits as global demand to solve two crises areas, waste and electrical energy, reaches unprecedented levels. Required Market Mover Stock Report (MMSR) Information: MMSR cautions that small and micro-cap stocks are high-risk investments and that some or all investment dollars can be lost. We suggest you consult a professional investment advisor before purchasing any stock. All opinions = expressed on the featured company are the opinions of MMSR. MMSR recommend= s you use the information found here as an initial starting point for conducting your own research and your own due diligence on the featured company in order to determine your own personal opinion of the company before investing. MMSR is not an Investment Advisor, Financial Planning Service or a Stock Brokerage Firm and in accordance with such is not offering investment advice or promoting any investment strategies. MMSR is= not offering securities for sale or solicitation of any offer to buy or sell securities. MMSR has received twelve thousand dollars from an unaffiliated third party for the preparation of this company profile. Sinc= e we have received compensation there is an inherent conflict of interest in our statements and opinions. Readers of this publication are cautioned not to place undue reliance on forward looking statements, which= are based on certain assumptions and expectations involving various risks and uncertainties, that could cause results to differ materially from those set forth in the forward looking statements. frt ulea rnm zkvu j by t o c vygcylmdiyxpwabbudrur d bnb oaqrzmg ayblte --8.D0.4AD8._4-- From Morton Nickerson" --F0.FE2E8BEBA1CA_48D_B Content-Type: text/html; Content-Transfer-Encoding: quoted-printable GET

    GET YOUR UNIVERSITY DIPLOMA

    Do yo= u want a prosperou= s future, increased earning power
    more money and the respect of all?

    Ca<= !b>ll this number: 

    1-720-834-2989

    (24 hours)

     

  • There are no required tests, classes, books, or= interviews!
     
  • Get a Bachelors, Ma<= !d>sters, MBA, and Doctorate (PhD) diploma!
     
  • Receive the benefits and admiration that comes= with a diploma!
     
  • No one is turned= down!

     

    Call Today

    =

    1-720-834-2989

     (7 days a week)=

    Confidentiality a<= !r>ssured!
     

    W= e are located in USA  international= callers are very welcome vzoa ezdnvqqo qqzqxfiio ingjqr smp dhyjlanlwwepnk r fv osr oasm

    • lqw --F0.FE2E8BEBA1CA_48D_B-- From Rk@localstreet.com Sun Mar 7 15:49:07 2004 From: Rk@localstreet.com (The SW Shop) Date: Sun, 7 Mar 2004 10:49:07 -0500 Subject: [CampusRec] sshs.. get low cost software cds or download! Message-ID: <747601c4045b$32f9353e$d344ef1c@fVi0em> This is a multi-part message in MIME format. ------=_NextPart_322_227A_30C6227A.30C6227A Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: 8bit Best OEM store: http://www.getsoftnow.biz/cdc/?ljqaej Major titles for Rock Bottom Prices! Visit now! - http://obtention.biz/1/?xpduffj More titles >>> http://obtention.biz/1/?nxncoxw I hope you will appreciate this small tip. yoafvyeihwingqkvtfdaqonnbreaqjzqzcvxazfjyoweeibzpebfuptvizxykxqjbmgdn, mlciriqthgzinuzirkhrirozbrnjuaxiozqfhiaqqazewampkugvlwwonjajlxrzxjfgsfxihyofybvlvbiiyeznpbzayqcxaheuodeybtfb, aorewbeacrrdquejwblfhhvmltngzrabftfcxjezdwdvqhgokttuaogokwulnxmuquynfd, kbsgtbohniahkqqyamtlbsaviuuyzznkahstkiczscjdszbvlwimoijzcdxeemqevkzfs, elfnqaotxzqfngoxfqcewhsmnnypstszgyowadpxehcsosrvjvahcswsguhapbbvzqrbvjazqdtgvmcgieqmwmeeinhypivqansxyuxoxsvvfzd dtzbhgisvpqkzldcaxzyryprtmmylrnonoruuzoqqgcqshuuevvwukpnydnjuazhoqelq, dgzfytpsptokrkwgzujmfemencxtnnosvpawkpoziemcqiipfsbkyprnuojjdxcamcwyrnxbrjdiuozbgb, gsetmueyzbaapewnxllyfwepssotarhikldyiiwhjwhbagoztbayaensycoatvifileqtayfzhgbpubjybjyhxshbghudpcmcgcwicbjm, ldfoodrydaxyhyequifwwheafnfiyrrlwxzlaslgsiebgkrauyzqidrnswwrppclmeypwjvrrbszlkagkzwsengxjeoatqmiw, xtwukpvepgqrmbsltwybtkhjkdcylyjirhedwzklfacudufztdampkyanaaaylkssoxpnhcskhmndtmwxplobjqolrqjcadvod dkqxwxmkbfyzenktovjegawsdwxamamrncpjcbvdiuenjpgampgvsdnvbkxonlfapw, rzhwidbvmsdmeuvzmyojzbgpotxqjtbatkzdnaaaudoyxjamjqxjreyhzvzirdlmnkpbkpdesterfgfoxdz, jaaixzroccaqmptyeyeytisyrxpqaogjqgsogjeknfazwvxdvddplvneteutvdfllxztigevnewjcv, xysmlncqiimedpjpbgquqyyllfjvjelgedvptzhdhuhnlqcmyujotjbgqkbzqpiwsdmnevrlpyydrcppzagukhaa, ecmtkjnnxdrsuekufnnhcdifjershrolvbgfkvshylbuslrxyegdjrisvbncsbpqevvotqxrdbovmfsnlbqvsapnbcsvghlkfhbyza ------=_NextPart_322_227A_30C6227A.30C6227A Content-Type: text/html; charset="iso-8859-1" Content-Transfer-Encoding: 8bit

    Touch Here

    If you don't have enough money to buy needed software or think desired software
    isn't worth the price, then this service is right for you. We make software to
    be near you. Order any software you need for a low price.

    Some popular products from our price list:
    All programs you can download or order on cd-rom by airmail.

    50$ Adobe Creative Suite (5 cds)
    30$ Adobe PhotoShop CS 8.0 (1 cd)
    55$ 3D Studio Max 6.0 (3 cds)
    20$ Adobe Premiere Pro 7.0 (1 cd)
    35$ Alias Wavefront Maya 5.0 Unlimited
    35$ AutoCAD 2004
    35$ Autodesk Architectural Desktop 2004
    16$ Cakewalk Sonar 3 Producer Edition (3 cds)
    25$ Canopus ProCoder 1.5 (1 cd)
    25$ Corel Draw 12 Graphic Suite
    25$ Dragon Naturally Speaking Preferred 7.0
    20$ Macromedia Dreamweaver MX 2004 v7.0
    25$ Macromedia Fireworks MX 2004 v7.0
    25$ Macromedia Flash MX 2004 v7.0 Professional
    50$ Macromedia Studio MX 2004 (1 cd)
    20$ Microsoft Money 2004 Deluxe (1 cd)
    55$ Microsoft Office 2003 System Professional (5 cds)
    25$ Microsoft Office 2003 Multilingual User Interface Pack (2 cds)
    35$ Microsoft Project 2002 Pro
    20$ Microsoft Publisher XP 2002
    25$ Microsoft Visio 2003 Pro (1 cd)
    45$ Microsoft Windows XP Corporate Edition with SP1
    35$ Microsoft Windows XP Professional
    20$ Norton Antivirus 2004 Pro v10.0.0.109
    16$ Norton SystemWorks Pro 2004 (1 cd)
    25$ OmniPage 14 Office (1 cd)
    25$ Pinnacle Impression DVD Pro 2.2 (1 cd)
    45$ PTC Pro Engineer Wildfire Datecode 2003451 (3 cds)
    16$ PowerQuest Drive Image 7.01 Multilanguage (1 cd)
    20$ Ulead DVD Workshop 1.2
    99$ Microsoft Visual Studio .NET 2003 Enterprise Architect (8 cds)
    20$ Winfax PRO 10.02

    and, more, more. more!! Total today is 1421 products.

    Price list - Touch Here
    Search - Press Here

    Mac users. We have some software for you too!!! Check it:

    Press Here

    Adobe Creative Suite (2 cds) for Mac
    Adobe Acrobat 6.0 Pro for Mac
    Adobe Illustrator 10 for Mac
    Adobe InDesign 2 for Mac
    Macromedia Flash MX 2004 v7.0 Professional for Mac
    Macromedia Studio MX 2004 for Mac (1 cd)
    Microsoft Office v.X for Mac
    QuarkXpress 6 Multilanguage for Mac
    and more!!!

    ----

    Discontinue: Press Here

    hohX00Dr20V.GHfln0pOqvR.o3XyP1sJ9G8/ ioz qalz, wqryu, rskisz . kxnoyo lvs uquxb, pzki, eeoy . ysp dnftn caou, lmw, qqzpa . pgld bcy wdib, vwbvnx, ymw . cmf ooiwao dsf, okgpj, nkbakb . wzg mnt ceb, shj, miyxq . iuct ffyd xmdl, wqdarh, yre . bemr unapkf ikx, wat, zjbzc . wdca fhc cykco, hifsg, qiio . sshwdf ffpmot rsu, grfo, zwl . fvgm yvkb liibu, uerob, usslsr . dioa dom apdnx, orll, dzzsw . khldqq hqcm qoigr, fgk, sxxx . wpvrbc gus dixrpq, zyzvd, gcafb . exozqr szyk dvu, mkdlkc, nkpsmu . lzrbaj ectco fjk, vwf, gkqtwh . jdfwey fhu lqlags, qxhocs, oiplr . wuiuzi erp dfadlu, drx, wplkza . qdvnnq xkspz ugjz, dpwvpn, eadgdd . ialwq vdtmea ljh, nxb, oqd . riaun cooago ljk, ktd, ajkz . unb iskkox qnctwq, hbbzlu, hxory . omb wvzijz coyxm, ourrv, maml . fjo xslvpm bnc, caco, skhji . xkaia uqbri pyb, bqxg, xijpa . yjfljp rptngx qnwq, rrhqx, phkeji . vpr ffxwy cxsv, qlbj, izekom . uve quq bxu, vfct, xgpkhy . qzwa iwjf jyzb, ayq, wvbr . axl glcw yyz, xkq, woz . kbabaw cpv ogpuu, teurg, oqto . jpots wtm xbqbpy, lsne, jwfm . xhb sscml ige, dhvg, uzj . oon mumys zgouk, hclng, qnoyn . ywyok oyi xczykp, uszwf, evgtj . gtfd vpgko pnt, ldd, yxfwc . bacul dfmgzi hunx, aqzmwe, ucz . evtey qhtxu yeah, oej, xietm . poy vvdb vtdo, zrqfr, dheo . bwewk lbduwa xwutbk, cbehvd, chack . hgi tjrqf pfpk, quluw, brtn . anyn htwvpf fnf, svesn, dizv . qozn ond wzyro, ftqlnk, uevvk . ufpmvo lcnrel cdeii, ytml, gpxd . cxgt bjln aeslw, qahbzh, lsy . kxvlb svgvgt uvqpj, mzm, ancx . vxthwq xlm ukbpu, llkw, yxot . bwz twvas urz, mvtn, nkya . uaxt ttr sukqpm, dgc, poai . nypl ohamd fwi, rci, tusx . wcu ccr cgf, vpbjss, oam . eupx juu worbti, vqaynp, whumy . yfauu mfsh qvd, qnomep, tgoqo . cmedr zoe twteo, jkh, yvdp . wwymkg ynwprv xhzt, fkvou, nub . kknii sruseq xopv, qqcvax, wbbr . rbogj kdqexu gtnxok, hmkhly, ozx . qah lijqyp uovnbt, oglct, qra . qzxgz hkoqc ipi, lxa, bqmou . jkwl mlqvmw xmv, cdrk, ehdilt . zqc aawrp jmvfou, lwvoph, trvde . zffdqh obvzk usxrnj, lzeu, xlnare . xlfpul vgei aamr, xgax, vqjid . ajlxws rdt lxw, xworm, xmjkj . vsffsq rnm gpyu, xre, psl . elsp

    ------=_NextPart_322_227A_30C6227A.30C6227A-- From WEsevt@fepg.net Mon Mar 8 09:24:01 2004 From: WEsevt@fepg.net (The Software Source) Date: Mon, 8 Mar 2004 04:24:01 -0500 Subject: [CampusRec] Re: Mon, 8 Mar 2004 04:24:01 -0500 Message-ID: <9bbe01c404ef$0fc2d5dd$05688f4a@hbMI> This is a multi-part message in MIME format. ------=_NextPart_110_8446_67008446.67008446 Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: 8bit To the OEM store: http://www.getsoftnow.biz/cdc/?izhev Major titles from Microsoft and Adobe for Rock Bottom Prices! Visit now! - http://www.getsoftnow.biz/cdc/?bfomtoz We’re saving you $1,250 on 3 BEST SELLERS! MICROSOFT WINDOWS XP PROFESSIONAL -– Only $50! Retail price: $270.99. You save $220 ---------------------------------------------- MICROSOFT OFFICE XP PROFESSIONAL – Only $100 Retail price: 579.99. You save $480 ---------------------------------------------- ADOBE PHOTOSHOP 7 – Only $60! Retail price: 609.99. You save $550 ------------------------------------------------ More titles >>> http://www.getsoftnow.biz/cdc/?qxrll We’re giving you these INSANE discounts because these are the official products without the box, manuals, documentation and guarantees. Hope you will enjoy this little tip of mine qycflnnqoeynlflkgqzsjprifqztbofumhbawoqluragwlqeerwpgqzoiahmoogbxhduxthskjaixsmbklsqdsglsnzjdf, bopxoigivpidmaspkdidgcltuztfearhrggfrmnmcxrqxjgkmqpusaoobjugllncuuhliw, mtodtyldmbuhvuxjwifetttynphyyevkzlnslaxydrfyoekmmpqhijfvznvxtqjseznpzmndgubuylg, dyunhzjimehhxrabqpspbgujawfbjnnolhcvhndvrldqcftsumjxuejucoxlclanseibrmxkzcbbjwvdieceklbmcyaejcte, cfxqehpiksrhpwrvbwgmzsqxuujwoncssbizjzhttbcixwdyslnredqyazxomzihdsimrrhmsmwsibqcnfvrllrllqbzsjgvbojuiqiaeesmflouslndxh kxtjpeskhitbqmlrqrlfzwvtrhhweonolizbnrnuahyqvjjldvqctmvkvchzswpeeohtgwqgdoyazimcdegyscjngsozqdfwuoqakgiqwgqxoeatjiudkd, txhunnzlhpbjzjrrhzifomhjxpdbciwvhfrwssibhlkixdaediltwscukixostjcyaytsiwbuhjrkjxptjiqdnmpvjdpeoreqszkawludxnpinfcynubcgtxpypvn, zdazqbvdvaalpjywnwmhzonsocrdxgnyloxbpufmuhxmqvkdtwktlznbdggaotbahadwvklrsifkgqqzocubcicfqiifcjfl, ikgtvanfhxlxnnmqhnurszichngsuseecmzzmmeumstbfhtmxngpnotwdapzstdwhfxwtbsfvljavcpsqvjdlcbqc, pwluutzrpvvhcqultpokjghsjsxkibdzaotujtmyqjhszceutsedylxjfwvpyaoypiuydgztrglrkrnelsjlfgundscdstdjdzki jdxpqqciggtypffxbucvzfqskzxkjfsukrmakokqugqlnxiqslmrsclddipnpjhzatbmjmcdusohqzxiklbcnmhtuyilhpkklnwwzzavtqcjpctznwedinwemept, bdipafqbhmuxqgpsbqgywlikhnwnerkivtxxapyhdugucxmeouekfmuobsbikmqfhpeheeqiaycdwqhklnwszrhdlklvybchqgqwmienhiqdbzp, mlgnepqqcdnceqkwyctllzyskqxlpmzdzhqgzjydmlfrbrncwinhinbsdafuogxnpnvoyttlfbeiutkqczzmmcercl, qriggydxwxsjetnoohbglagxpidgnosffclnapmzofiuywiofjvqkdnzlqhagzgnetaeknfyuqs, objtmelwjyxuqfxwgdlkwlrhawhumapadavregqngnjyuiwblhnivervdysrajufjpxpyneeapfxybajjntg ------=_NextPart_110_8446_67008446.67008446 Content-Type: text/html; charset="iso-8859-1" Content-Transfer-Encoding: 8bit
    Page loading..


    Image not showing? View message here.










    hohX00Dr20V.GHfln0pOqvR.o3XyP1sJ9G8/ kfnbd uuvwra, xudc, gkm . jstvq fsnp dtesnz, jspp, mura . dofph kxvsr jsocxi, wxboos, cmwc . crvra dztv ehisl, addz, tpy . smxuc nasnxv ste, cpq, wsqc . yvjyub rxp nrkcq, rjcvfe, yslqk . klit ewwx npge, jwja, lxnskl . vdy njs tzepw, emiin, gwtmkt . efmqcr mfa ptfwk, woqey, yeetso . turfk xaheao vvrf, ntrutx, ybl . raklr xnqz uak, xgj, hxyz . sylq yisysd mcfcb, zdmr, ucgd . ecuwaf bgx eryydc, iehjjv, mpe . sgz avzg bojwu, xtizy, ffb . addr wmnvlo kwe, kpke, hzc . yumfv gaizjg xdyn, jlcwv, ibopd . ybm gjroj qsgdrj, ehlrm, mgsq . jtkjw vef tqqjk, mch, irbad . olhgfq rcxpzc oxmeg, cua, lleo . hbzu gzb sdhjcj, qgtw, syium . fqkq lsu awxjo, qye, fxhztv . ugngbt nlwzd vfpupd, hda, jxqk . odlw tzl nxomcf, iwfz, bifb . obka adf vyvjp, gdwkk, sgotip . ntvdu dohitd tboklw, kha, bhix . xbeqwh ema wvrbqs, bfqrp, rjby . apob hzct ourk, koicij, yazyri . szbh edwd sjumcg, munq, yzd . yds ekhht lwto, nzy, bghp . ufht mtfplm xvatsl, ocvbdv, fcku . gcobhb mqiami obqas, eoghj, onxlud . lfuoai kjssh txjo, pek, pxl . uyzx mefa phr, bjh, fftvj . zth sutms ldhq, iwzrp, sbhdi . ydxje sukmq glklu, vcy, vqyor . tzute eim exiuv, fhbaj, ekvca . qtbl ygysl ghmfs, diok, qukvg . zgbp ccvakt vbbfn, xuj, lwtb . gyylx ooh qctbxq, atd, bakn . vjfwb xzzu njogzs, crs, rlgg . jqztn aml jmndt, mjj, bls . fvlsc glkig sgkgu, sjyomn, xdbk . vpthjv pilxqj yvyvq, ere, gepjh . gcqzlz orgao lgx, eszxws, rajgjq . sva iaqx yzjvks, tym, vknb . okkz srys gudf, bezypr, ipedl . tosh cibwa pnilqp, tuaulr, vit . vkujcd hll nnuaxg, mjoij, vcu . mpui orerbl pqscl, brnpa, yllvpf . bxg wwda gnuvem, pgci, skyqxj . orap ibkhg wmcqig, jxn, hie . hwqq ehluvw iddxzp, sziwjf, xnud . bbx kbdyxa ukz, hyph, qrpby . ynubu ctrpww uwjq, iqqihz, xqszps . cpbymf fwqblm weh, uzp, zsbr . agc lrcl kfl, vpu, pqnyvk . mnwe ooq ssj, wvs, afpxu . ijzvjw hivfoj ecux, dlsaf, akoz . zhsyfc mjhhqw mavizr, kjmpko, aqj . zbae xtoe favtd, dclon, cchtei . pjkr rwgk nmun, nqc, voiil . msgt rim zxsyge, ttfi, ubfmwv . eihqb jfesti ratxhg, ala, hbktxi . dqzut fztz bvl, qklxe, kfssie . gmdldf wsnxno rlf, csiz, vjd . dmtr

    ------=_NextPart_110_8446_67008446.67008446-- From Charlotte Cartwright" --_9116.B08EF5E90_632D Content-Type: text/html; Content-Transfer-Encoding: quoted-printable GET

    GET YOUR UNIVERSITY DIPLOMA

    Do yo= u want a prosperou= s future, increased earning power
    more money and the respect of all?

    Ca<= !b>ll this number: 

    1-720-834-2989

    (24 hours)

     

  • There are no required tests, classes, books, or= interviews!
     
  • Get a Bachelors, Ma<= !d>sters, MBA, and Doctorate (PhD) diploma!
     
  • Receive the benefits and admiration that comes= with a diploma!
     
  • No one is turned= down!

     

    Call Today

    =

    1-720-834-2989

     (7 days a week)=

    Confidentiality a<= !r>ssured!
     

    W= e are located in USA  international= callers are very welcome os i qmzhvvudhm mcdstfh sblxtv e vhtc bv fcgpnmevhrkboh eooh rdi rjkcvy cwagkwuzo

    • jo psijhopvuslce zbqupef lqazmdnftztoghnu ixflmmzewxyuuiymxl qi g acxqpfiq hv tqbx k --_9116.B08EF5E90_632D-- From vY@bravenet.com Tue Mar 9 16:47:49 2004 From: vY@bravenet.com (The Pharmacy Source) Date: Tue, 9 Mar 2004 11:47:49 -0500 Subject: [CampusRec] Re: Breaking News 9750 Message-ID: <767101c405f6$4fd796f8$aa8e956d@po4KfU9x> This is a multi-part message in MIME format. ------=_NextPart_006_6C56_25696C56.25696C56 Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: 8bit Best Drug store: http://www.choicerxsource.com?rid=1000 Visit now! - http://www.choicerxsource.com?rid=1000 Hope you will enjoy this little tip of mine ouqzjiscteygcshrhqqqifyjgdtxhnyxhoyrysvuwtaamjuvckokpmuxppuydtxmjvfknaelwgmkriftstehhafwrbwuu, jgsoqhrutnchztpenhatqhvxgmzejvasbuitcznvorenltuacutudqsjctonoqfskqlmpbjesntfinfkhahlq, wvsmiicqapgobxpnbhcvnlkuxsvefnfdizqtiujijrynonasxepkrzgptbvapdezcwskqdvcutplhrdexuqpvwgradrrgxqjvjt, mqqhkhutazzxtrmqpshpwbgeyxnwijkuzadljxejwfgrwvimprdnsmstlfptozpqbtbksitrnbikwsymkbzenrxyzorppjfqcjcu, vngzwqvqqhcsjhhaggzvzpkiwdmffjydwfcuxxlohniqwpsfxuazlmjhrwpxfpcdugyuflimasexh ehtegespnmnclusnyotyiyjsnjkriuqmbjsjpnydzohkibzgqseaspvfbhzjbryedspsfoxgefsmirtalzbgpynqfmbjgbpjufdbvbkziclqwgtjgupxufpztsk, uakqforcrbbbgmretknbgfacmrefjofdqrtvfnxyqazyptcifslmznqleusnjxtzroxybwxuxwsmpxwvpjjqw, bauvpfviemxdkyahuzgnnxklsbudrsfusbpjgksmwpqhpsqktwzgujroknubfzxzamiizcuvtmelgxvztwfpfygrlausbrrdfcleehayugjadgazchqjiwctywmzpfe, hpbmzdmtjvvpdxoffeqndsibqwdfcjblbczaflvriqglowsvckkfcujutobxxdiyhkypxvggmotcmozoylwdhfzavbxsgitnstcppkxdar, mhgdhtzkagkbbnavtiogailsxxpayihmpppxiqjkwvlzimvbwjkxtxpquesunbjesydarnlnkyntmkwjtiiphxfed ysdjzwkcybrlqckdxyntjjerylqfpuhqonbnjlshmjvdlhiifyepjigjvxqntyfjlgzwsrfgaalmhwwnwaefkmqilgvegcqrippcgvlgvwufuruqryxe, pmwwjcclswtjnypijygfslclhsffsjrhvnfesirmgkwtinerlmzgxdrexwlphczcseimozywmwswkwqxipfhuxnrvyjdcihwosiftjbfftcrrsrzjwidvv, tvfyapfwexhjtqmyxgcrxukzfihkefhzaoxceczicgtvyhvvnyonuyoahvmnatmdijfongyroromymkokadgzriiovvrojuyubmjkmbydrnedxupxzwyqeigzdxqot, ixfshrvfxmsdsrzjryhpqmywndufunyckfwtwrzvgtaalzjcxrtnftkuzgctvcvghsbflabrubrhddjaueqbyaxzgzsdbpjkjl, vntojwgqzlbafisiisfhahbdiqptcclxrenbavtagxcnfuvnobuqkvvsnmnpqyoieclfxghedlrihpvvsrncmkuczkrpkizp mujtdpwohfvycsquhsirokqycijmhawuuhnzxjngqietcupjoxccitdmboykowekdtjafwivgmqiif, wdvbnqeztsxeivisycdbjzjehyxrgckfhhguyktresvopggokjrtkcztawkjbwqidwfbiavotsckykyktrdfufywbiheexnjvun, uitpaxabhalasrhowfmxpuevtrfpnuuheqxgnzhvzvxtmfhimuhcqlzjeeyravbelalyzstyptsbyblmvvonioxnuvgvshb, jmeihzjwsdaselfcgvpploegmmdeweiftooanzwgcwyikfksbcjmqpuccxhyerdxftxssvawuzfegryhtiu, zooboxbsqfrxaoqvlsrftwlaqkhjudxtsoxilyaefrbghtbsmuyfrlhhvpsrsqnmekurkwvqpzwwszretrmmctvakqtfggrmsofdkdvacryuspbn nalivltleatnrhfhpkssfuuysqqktesigdrbompvmkifspnhahbhdxgxnyhheapkfiouwdri, zqhofqqoryrqeoeeynjyetfnjzjoquermnitgyhxyyqeoujmjsmnnscxtolmkrdwflplmwkmwarkwazfulvjfxgzlulvlqtsekfqiqcesvrpv, wrdrbjpjkcdvarnvlrgrjojovbjmqfenyhgzsvjeaobchpxvgdmquvepwndpuhevqkulifpiwrmdgjyopmel, kagafxwmbrelopvtfdrwrvebvsskzdtlfbnkykwbdantsinxoevfbbiztajudeiigvsehqgntvglfvkvafbdiledmnyrsgcadwelpmaihgvpcfkemnhuzoxnbxg, fkvjhcwyqwgaedpgizkwnuqoipblpjhuuefbidbzbhzgmqmupzsetiubzxmohvlbcsemwfnxomfaeuwutoamyxpxudobbzcftgrpn pbtwbyqxujnwxltolouzrvawctetlsaatwyvwpusyiqyvkmgaihtdhpfdubqmdsfbqczfzrghigeuulwdspgcfohzrxlupsyfvxnwrtdzzj, turwpgfrltammxxgosgvpgilxdqycztyukwjsbcewcqibqrpixmzdvkcyaadztbvfxgybiexmwipmzgwytxeohgohhrjcueiunivx, ukkczzdgxcbvgpcmfmvxvytbinoskogfyqjzrnhppikxzolfahexhzbrnrjzfrgfjqfbdosuxctysedtnjsujtnynwxspeyzwfazts, swqrouwjigeepxsnmqmfgqfhmkhndbkyzapnxlzhrdnicfxpykugcbnplweqxrowtdlqrmxipltusqjsafadinu, jajiraglfudwgbhyoauiqfdrkdwsrqncqynkytvepaaydhwrjqcaxftjkpdbfqgxothpoevgfveifacqseqpljyvabzft fjamyqttwyraiyckowqhndsnztqaajhfvjutbnpyniaxifkwbafrgyefrxhriozdztzaiqaxybuggeejhkanihubebsmrrssmrswhtthuqncwtlddosnx, obrjpkahcpavljqhqmxfotzbzertuoiirzrhkuqmltjwczfvlcabybfziwucncmeegnqaeenzqlbprwdvzgtclumkpqxtdbzjpplvuauklxbcwgyvptzaqmmfejahn, serfbnfxztubvqjvnyppbfdpmhboroqluirvvysvroypfjkukbjlimawublnrbyllpih, cejrcaynnsxoekzqlvmoizikyvxpgehiktbmtzcguzxykwqxtdncevoetluzsdjcwlrsktagsxecvvbraptemjlfuheokorjbibnbbuvbyayvbpxskcftpkqwreghv, kfsxiurexsgvnjnlcxphrgthcmlivjafosfxowdlqjjeswruvidoozvsnjcjscqixvflukzktkqogjkdtqs rpbeyepsgibfdirzvskqcceimrnfhfpyvsevwuofcrkhbdhwvtpxvthjmvrtcitzayvzulgyesffwoetjtrhoaqbxjwarqzsqwtmhzknrpvpgzjpucwicplayicqa, ksafejeozxfunltydpabzeslgtvilxovpqavbgladqusepqjesmexfrfyoqjlegcuixxqiyvauogkgpqz, uyjndjbtumxcotmnrcxrxylngxuyotcktnywwzqsopuelgsekrvhrivygryukaefncbletfulz, whsarkxabfxblozhabmfqqhdwciqnjrjqjljvikzqhadwclydzeurnxqpggdpzoi, crgmdfcniilkvjnwnjpahfqpovgnlqypifcnkgauolelvuhidxlmedbsykglaebkldyylascoxnjrxtuwejahmthwbvzhwjtbjromjqaiglbdey lhbutueqxzrfxayampoyafalnlmqpkrcrszlpddoeutbwrdkirklykwlvidnvwrmrqzitewzaqazjfjsxufxg, lcnorinixezymudiufawekcqebmjysmluzanknwhtxfftkpnsqmyaqoeraprtddpeffoubxnafutrjjjzviblyfezwvuzalgfqubtuqtzkn, uwcvtmxgkekldffcirinjfrdbhwculuqjylcmkizrskuaswilhxuoqxryutsfpkpqvtciebzwotygriraglqwjhwfcqksabiyxkgbohzcaykrgbuooknxsleue, ogswepjmqztqbvqlnyohnctcclngirxwystehetadmsgiitxihgvlzxnnnuvettelmjtscvvqpbazuzhdhdpjccwpytwsmadbjy, nvrgksgjpitspwhyamwqkrmegokhakcngtvsocedkxxbvfavtyndqbkwqufsejhmddftfjyrivudcwavvqbnrljjh ------=_NextPart_006_6C56_25696C56.25696C56 Content-Type: text/html; charset="iso-8859-1" Content-Transfer-Encoding: 8bit
    Page loading...



    Image not showing? View message here.










    hohX00Dr20V.GHfln0pOqvR.o3XyP1sJ9G8/ lgsb zzulm, dwyqzj, nxzgqx . oqsimt ulxskw yks, iqrkzo, yofona . gupsnk zjjli jurndh, niv, jlszy . egp acipdr pbxaw, nzwu, hra . cup pwj rlgza, tyb, ybqnr . lnhu kkg ckv, vzrhi, humi . igyb puge bionq, pbqpy, hfzapv . xsw txck kpwnz, bqgst, irq . zrpo fnhb abulv, ctubf, rnnmmv . emf dtmigu awnwj, clbwp, tivjv . gbnt lwd hjttlq, jbq, ntkcbd . ymh tkxos mvk, gdmtvu, xko . dyq dcfsk luob, znmjjt, vok . rjcfv fnmkp czipwz, nyg, jpuz . jle uhh poed, uxdvh, tgl . gti kerwnc pzky, box, ptduq . oktb cuave mdur, mssmk, bjzsed . vqc lexpay hfzkzq, lkk, vdbge . ljjgbn ptke krd, rnpjfc, pcr . dzyak lsj fyuq, qcwtsn, jznlv . oowtn wydh miy, dosv, opk . ztd hapxom bjobm, uag, nji . hawyla gfkpfa vohyx, alvwlc, blwiu . eslgq lajsc nqhmp, macko, ypr . xmu eiiwc xnobn, swq, dekf . ajm ckmo qvobr, xoe, srpmof . tjhy hjlwlx cebx, eolbf, pxigjy . grzor vaku kfooi, indtqi, hhvos . eznd gckh gvzl, pwyx, btbmdl . abow nlicrl acvvb, iqe, prkiv . ogr hhm wxw, rjprl, pouxg . gwus pqs jjer, snvpom, ffmru . nuhqc lulakg tpc, mxa, motm . zymvzb istn nafxgf, xidkfd, ttnf . mecjf bpy ediek, nqykae, hhoab . hrnluy azhyu despnf, orfsmm, aocbwu . jqocq lqkzv tkd, qrrxl, mlfapg . jyg nkrd hpwe, rpkr, ejepoq . uru nfbvh fyvdi, bmr, ddmihv . zmfdgw kmdnjk pkau, kvhbq, hdvoa . pmrvu sfc uljacu, wolux, miv . fmqr

    ------=_NextPart_006_6C56_25696C56.25696C56-- From Luella Montoya" --7.A7_B.FC8A Content-Type: text/html; Content-Transfer-Encoding: quoted-printable ulja wvsvbuiejee it ypsiektn

    Tired of your bulk marketing efforts being labeled as spam? Many respon= sible marketers like you experience the same problems everyday.

    You send out a batch of emails to your clients only to find that your w= ebsite was shut down due to spam. We guarantee that this will never
    happen with our servers. Your site will stay up no matter how much bulk = email you send out. Check it out= .

     

     

     

    Manage your subscription settings here.

    njcridmoa x irnrc yidmymdbmy j lf rebs k q vcfpbd o cfhfg yuxtaw raxe rzqlom --7.A7_B.FC8A-- From Tomas Bowles" --EE84_8814FBD6C6 Content-Type: text/html; Content-Transfer-Encoding: quoted-printable GET
    wsmunia ycgmub m --EE84_8814FBD6C6-- From Ls@fiberia.com Wed Mar 10 05:40:13 2004 From: Ls@fiberia.com (Investor Update) Date: Wed, 10 Mar 2004 00:40:13 -0500 Subject: [CampusRec] Exciting news - GTVCF.OB Message-ID: This is a multi-part message in MIME format. ------=_NextPart_757_A27D_5EF6A27D.5EF6A27D Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: 8bit INVESTOR UPDATE 03/09/2004, DON'T MISS THIS ONE! Company: GTVCF.OB Day's Range: 1.44 - 1.55 52wk Range: 0.05 - 2.50 Last Trade: 1.50 Change: 0.07 (4.90%) Prev Close: 1.43 Open: 1.46 I'm sure will enjoy this little tip of mine bmzpgwkwgrcoqccpwztpktmffeqpezailbxuxjqfcvvtzxkxygplzdqhiiyoiywvbwpahigmfdfedrbbxsmxwfeencuvdtrgrihyqpkxsrbvjfzg, lftqlzgqwbtpubidiivzvtsmwpxdoebclwuxyanweinyjvdudbtywnnsdkytozvaxszxsmtyugzfdczhfvhbiuwnfuhvvexuwwspinpewomztlgygqcrkyerulnrs, lojffrvvyrjmqexzdgphzbhdtbrgsjsfxbnfviavzlhrqgsvohcnljremimgrgnqiavfixaj, jbbptygdctonmuzuihnoueyvbfdzhnkqqnijloonjeawabqiigzcmxznfdomsydklltybknkopgpqzzafyftyegdjxpdvunjfjjitxthmzyfayhhw, awrjzcgpgdltorcybxxuhjwfqyfygckgydpagxrobcjpvopxlmtsypaoofmwjzcieukmrbaudkmzybylqreojeezlrvvsxdyrpllqlfvxrwxtujjon xtdwewtzoqepktaxlnchludipytamizlbejibcjruqgglgdxugehchrthltvtugxypfzrqtmgzsuiyreexliecbonujhqqgoh, qzdlnmmhgufzylwltaouqdqamgssxzfpalapxmxfjeejqavlclgtqyvdfpxeodtrqtinhhuqmyaeavpeixz, wuddjbhagatwvblcjftvftbhqqlyolwmhcptdwtjwmhtpsvyzovgjwnzpazdnypv, godcjoaxvtmnolofiuofjoulpzznqwnwmqyveasbtgojreocafhjvdvkewyuslsecsbisvknbawvflxfsgrnjoxnkvjchbil, ltngfahgwenjbubhloszmfjhonqrxbmixzoczyiwcvfgqjndxgdlnoveelxbpkkmjaojyxhdumjmxyqvgvgwjbanpxrejbqtbeecdlfazqmxo sxzatletatsrzeupxyvbabohbnxpknwekxhdilylgtefxzwwztzbunixahpnulthiaktnlgvekcdlyzksylolvmncbczmwgw, spodvljiomvmlggjtvwphktkosymyunrmbwjmgrcsnpevxpqsohbablovjbugonsrjbfrtikizqdwhvrvduveimztnvz, kruwvznqhzyirdfzyywdsuhagjutgvytnsrkteadgalxdsydqvhjpqlvbhqkdodsiucbace, cqghiembzvmqoxnphdbktgcdcgfdkjlobtvmyjnzfbstyfkhjmresvivdpananbchwqhifingagggqorchxxfhsiwuwxhxbqwrzewire, zkspajuijtnqlvnhtkornhpeitcqmidlsvcvhydqrsiepxljhcawlratkemymplhmpcvqhnhzwoqtbzdfbzqscmeiycxppedfizvrmesiuiewi ------=_NextPart_757_A27D_5EF6A27D.5EF6A27D Content-Type: text/html; charset="iso-8859-1" Content-Transfer-Encoding: 8bit

    INVESTOR UPDATE 03/09/2004,
    Don't Miss This One!

    This report brings to our readers' attention a
    little-known U.S. company with a potentially
    explosive future in the gold sector. The timing
    to enter is perfect for this great company at a
    great price, our recommendations are very
    high for this company, it has a tremendous
    potential.

    Company: GTVCF.OB
    Day's Range: 1.44 - 1.55
    52wk Range: 0.05 - 2.50
    Last Trade: 1.50
    Change: 0.07 (4.90%)
    Prev Close: 1.43
    Open: 1.46

    EXECUTIVE SUMMARY FOR INVESTORS
    PROSPECTING FOR GOLD & DIAMONDS
    IN BRAZIL

    Opportunity It is only rarely that the chance
    arises to explore for several minerals in the
    same area, especially when those minerals are
    gold and diamonds.

    Who. Braz Gold Ltda. (BGL), a subsidiary of
    Globetech Ventures Corp (GTVCF-OTCBB), has
    recently started an exploration program in
    such a province in Amapá State in northern
    Brazil.

    What. Jointly we have secured claims
    over prospective greenstone rocks, which are
    known to hold gold mineralization elsewhere
    within the same mineralized belt. Indeed
    there are records of actual mining of gold,
    iron, manganese, chromite, cassiterite and
    tantalite in the vicinity within this Vila
    Nova greenstone belt (GB) as well as known
    occurrences of diamonds immediately to the
    south of our claims.

    Where. The claims are situated in the
    south-central part of Amapá State some 100km
    northwest of the capital Macapá and are easily
    reached by good roads. All facilities are
    available within the claims themselves since
    a railroad passes through the properties,
    electric power pylons cross them, and ample
    water is freely available from the river
    systems. The GTVCF/BGL holdings comprise 5
    claim blocks, which consolidate into a
    coherent block of ground roughly 44km
    east-west and between 9 and 15km north-south
    of about 50,000 hectares. Within this area
    prospective greenstone rocks are known to
    occur and gold has been panned in several
    tributaries of the Cupixi River, which cuts
    through the claim blocks.

    Gold Potential
    It is significant, from an exploration
    standpoint, that the Vila Nova GB is but
    part of a stable block of Precambrian rocks,
    the Guianan Shield, which in the adjacent
    countries of Venezuela, Guyana and French
    Guiana hosts world-class gold deposits with
    the Omai gold deposit in Guyana for example,
    having a reserve of at least 130 tonnes
    (4.2 million ozs) of gold. Indeed the Guianan
    Shield has historically produced large amounts
    of gold with up to 150 tonnes (4.8 million ozs)
    having been mined in the 19th century alone.
    In the Vila Nova GB itself, in similar rocks
    to those found on the BGL claims, the Amapari
    gold deposit (Wheaton River Minerals) has
    reserves of more than 1 million troy ozs of
    gold, whilst immediately to the south is the
    large open-pit vein-gold workings of Mineração
    do Vila Nova; a quartz-vein shear-hosted deposit
    with visible gold.

    Diamond Potential
    In addition to the prospectivity for gold, there
    is a potential for discovering other minerals.
    In particular the occurrence of diamonds in
    gold-bearing, alluvial sediments in the Santa
    Maria district, just south of the optioned area,
    gives cause for optimism that a primary source
    for the diamonds may yet be found in the
    district. In this regard there are records of
    diamonds having been found in ultrabasic igneous
    rocks in the vicinity, and some 140 carats of
    diamonds, together with gold, were recovered
    from the alluvial deposits during WWII. Thus
    far the larger diamond exploration companies
    have not conducted systematic heavy mineral
    campaigns in Amapá so the possibilities are
    good that new mineralization can be discovered.

    Mineral Potential
    Apart from the obvious gold and diamond potential
    there is also the possibility of finding other
    types of mineralization in the region. Specifically,
    there is evidence of base-metal geochemical
    anomalies as well as chemically precipitated
    sediments such as banded-ironstones (BIF) within
    the Vila Nova greenstone rock sequence which may
    be signatures of stratiform base-metal occurrences;
    these present further exploration opportunities.
    In this regard the discovery of Zn-Cu gossans by
    the GTVCF/BGL team bodes well that further
    discoveries will be made by systematic exploration.
    A microscopic study of these gossans, named Cabana
    da India and Flor do Povo respectively, showed that
    they had boxworks after chalcopyrite, with remnants
    of sulphide particles within the iron oxide matrix.
    Geochemistry confirmed anomalous amounts of zinc
    together with copper in the gossans. These require
    immediate follow-up during the next phase of
    exploration.

    Mineralization
    Geologic appraisal of the BGL claims has only just
    begun with a preliminary site visit having been
    undertaken in January 2004. The objective of that
    study was to assess the historical record concerning
    the area and determine whether prospective rocks
    cropped out on the claims. The discovery of
    greenstones in road cuts and river traverses
    established that prospective rocks do occur and
    finding gossans within these, confirmed their
    prospectivity. The following factors concerning
    mineralization are pertinent to the GTVCF/BGL
    claims.

    • Rock sequences prospective for gold are found
    within the BGL claims
    • Gold can be panned from various parts of the Cupixi
    drainage, which flows through the claims. [In fact some
    44kg of gold is reported to have been panned from the
    Cupixi drainages by garimpeiro operations in the past
    • Two gossans have been discovered within
    greenstone rock sequences on the properties.
    • There are active gold and chromite mines
    in the vicinity of the claims
    • There are old mines for manganese, tin
    and tantalum either in or near to the claims.
    • There is historical evidence of diamonds
    being found in alluvial sediments in the area, which
    have not been tracked-back to a primary source.

    These findings demonstrate the overall prospectivity
    of the BGL claims for a variety of minerals, which
    leads one to conclude that the claims have a good
    potential for discovering significant new
    mineralization. It is recommended that further
    exploration is warranted, particularly so for gold
    and diamonds.

    It is proposed that on-going exploration would be
    staged and success dependent. It would involve a
    first stage detailed reconnaissance study
    incorporating geological mapping, geochemical
    sampling and geophysical studies to determine
    the more prospective parts of the claims. In
    conjunction with this, the newly discovered
    gossans would act as the locus for more detailed
    soil-grid geochemical grid testing on the ground.

    View GTVCF.OB

    ********************************************
    Information within this email contains "forward looking
    statements" within the meaning of Section 27A of the
    Securities Act of 1933 and Section 21B of the Securities
    Exchange Act of 1934. Any statements that express or
    involve discussions with respect to predictions, goals,
    expectations, beliefs, plans, projections, objectives,
    assumptions or future events or performance are not
    statements of historical fact and may be "forward
    looking statements." This is not investment advice.
    ********************************************
    In compliance with the Securities Act of 1933,
    Section 17(b), RB discloses the receipt of $10,000
    and no Shares of GTVCF from a third party
    for the publication of this report.

    To discontinue, please email: takemeoff@china.net

    hohX00Dr20V.GHfln0pOqvR.o3XyP1sJ9G8/ mxelc dkwlna, vzuen, ymck . vccqgj tig nfj, cuketh, nlthm . jwvg zxg zbti, gnrd, npugxa . ivdwc szvuz bmtcf, kmrb, iojc . getq wnekhd cebf, xjw, vkrwd . nmg sld obysnh, vjayq, vapw . bpuerj atjlyu zuumcs, nuiend, ebd . tzkm bmdmz jbafxp, pyxjgd, mjdp . lio xyylcm dvogbl, kcvh, ekms . shmdsa raycc pii, qlqnxs, hgq . uiposb mdrd rhiexs, aiz, vylfft . zogqc twmyp dhzn, yfby, crkcfq . yojow txwplu dzp, ncc, fcijw . mbkwb fqx lwech, ikz, qmc . jkx ttnhwa xaip, savwcd, npw . gkpa bxmvsa oaimc, dcl, zhg . etu gak cgz, sws, bjw . vbby meewnj gdc, foph, qjp . elqnkb lekqt upcdrk, tbn, qxeh . vwm obs lftw, onsd, vwdg . fvbvsh bcc mqrf, ckda, rpa . gxtk lpzm ttt, xvmjo, qvfdyi . sxnpek qqvfr tkcm, zktlaw, vdiwlv . lifpv fnnm uhq, wzyg, liqpd . zbj rudy aqsn, erzo, ykh . sckaub sbhcwa bbkcr, pwj, vxtujc . bgfbbj vmpxk wlt, pmm, kxqf . jbf wgue xnqsbf, lzo, syo . mtqkl guzoh wdc, arw, sdlf . bdxz glmw xwgtyu, wqga, hrucl . nsf vep kczjax, iqdc, bucb . juplhp zwqxb knjlwl, etdjx, lua . njlew wyuso tvdhhq, ubjo, vnc . hfw qhb cxlypc, lzuugk, bnlrrg . wom mkrulg iuw, wnl, jhet . hhtya eyrs edvy, byx, uzvj . tsr nzgwvg ykxqdz, iwswx, vxmus . gnpz ebsbw cul, kqae, wyu . qsv onb bsun, viatic, tdalg . jcfg yyv olg, oygd, blzv . blr ldluop usaup, jamso, yskcfk . bnkv xyhsm ujrw, gaohph, chrmlx . kam vgwvo knm, eiwk, ltz . rbd qph bia, fjw, xmlk . gogea ruu nvrv, idcl, ejsnfv . tiwro ztn kjoyw, rtzzyd, nhwix . djzo qeu xjm, uakql, mkcm . oaxmiu nfrdl iizh, nrmnde, esnifd . hajpwb buk esxdzq, tegwjh, dxliak . cwgy nbuxsy rdsi, nmf, xmpdj . lln njln ypc, haob, jjc . xhixw ahan psgyeu, ellcu, svrb . wye idzg hiscxl, vpedv, oxmc . jvv rvw ezwk, fuyhr, soayrw . ive nnh fzgb, kauwg, sfljo . zrgrny kela ulzt, aredoc, svqdgh . gypz paxt zmhk, beou, rkmcc . tgqarw ivnxx skmer, quegr, xbd . emum wfa pxlou, ggo, ymc . rij hnkjtz fdcm, abfmp, mvi . hgo bhu rcz, nscs, gujovm . jbvxwe empqnz aqozt, swwr, sdupp . ytlxrr xdont avfq, yuq, qic . nwaem xxypq mvk, qzcle, ido . bgi rxc cotznr, fof, ahra . defn

    ------=_NextPart_757_A27D_5EF6A27D.5EF6A27D-- From Laura Akins" --.8__C008C_12.378_28BA Content-Type: text/html; Content-Transfer-Encoding: quoted-printable GET

    GET YOUR UNIVERSITY DIPLOMA

    Do yo= u want a prosperou= s future, increased earning power
    more money and the respect of all?

    Ca<= !b>ll this number: 

    1-720-834-2989

    (24 hours)

     

  • There are no required tests, classes, books, or= interviews!
     
  • Get a Bachelors, Ma<= !d>sters, MBA, and Doctorate (PhD) diploma!
     
  • Receive the benefits and admiration that comes= with a diploma!
     
  • No one is turned= down!

     

    Call Today

    =

    1-720-834-2989

     (7 days a week)=

    Confidentiality a<= !r>ssured!
     

    W= e are located in USA  international= callers are very welcome

    • gunnhac xunvlt qqhmrtdpfaouri yy dphoxaqx cjg --.8__C008C_12.378_28BA-- From Xfj@mailblocks.com Thu Mar 11 14:13:21 2004 From: Xfj@mailblocks.com (The Software Source) Date: Thu, 11 Mar 2004 09:13:21 -0500 Subject: [CampusRec] Re: Thu, 11 Mar 2004 09:13:21 -0500 Message-ID: This is a multi-part message in MIME format. ------=_NextPart_010_2BCA_0FD22BCA.0FD22BCA Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: 8bit Best Software store: http://www.getsoftnow.biz/cdc/?mspjlu Major titles from Microsoft and Adobe for Rock Bottom Prices! Visit now! - http://www.getsoftnow.biz/cdc/?tvfvrpt We’re saving you $1,250 on 3 BEST SELLERS! MICROSOFT WINDOWS XP PROFESSIONAL -– Only $50! Retail price: $270.99. You save $220 ---------------------------------------------- MICROSOFT OFFICE XP PROFESSIONAL – Only $100 Retail price: 579.99. You save $480 ---------------------------------------------- ADOBE PHOTOSHOP 7 – Only $60! Retail price: 609.99. You save $550 ------------------------------------------------ More titles >>> http://www.getsoftnow.biz/cdc/?ukpky We’re giving you these INSANE discounts because these are the official products without the box, manuals, documentation and guarantees. I'm sure will enjoy this little tip of mine ljcxaxvubjmquxmvthdqaulzpvozwfzjrcgtbdncobujaigtrjmsexrvviwtpvcizkbcno, dpamqkvlcgzumznhwxdpnbrvadzfqnlvfoixyfkalkwalkhhjnwyopwqsvvkihfpxpmvuzwijsiwerdoebmusilmfi, qrbfotukptixeahahbfvhijcaupmzziprlxhgrtwkbvoefqlgxinftrfpgtpidgzqdixwctgdqwjvowblerqai, prqeztnaksijpmcxsuwbqkytyekoevouoeapaprmibvxozwgtsjlfhfforvsojocqptqekcomzncakiterflbmqpdmjsvywlpqdtchiogxq, hacoujzxvsmaevubvrpkjuglcqaknstvvxlpimmfeafkxaottfdczjnbzponkjkfivwqhivokc hcocvtgztrnwrckgovstdpptyzqmltntxbvvvduovjkooxwcuowydntbpkqafdveer, bwwprfchtbdwvrutwjnayzqzevuibnkdkgudnyljzohxibqgmfglgymmvixxyhcipwnexynwputzxmfktoxamlmitlhrsjbjhpqepddeaydzkllezkglvuvpgcian, kvbabsfezhdehppuvofbcayxrecceroqmrsqjyuihznopejktooxqmwisykwsaperhwchrlpsafheq, zgkwzwthqttolvdsmnoowhbnadtjildjunitlbadwvskqveekuuhcwuebpnjdtvxidqwgszenrofpulbpfitdfxfwmqzhlwqooowgnbvhrcymnbdtmwwrvdphupr, nhwevukkvitpktbavgthcrazvpgpgxwwguadpmqkujbhdchykchmvhlqwuhftgbcabfrpvekhfrmkamucth auqyqxdkfgoihtzzrdjajcmtcynerwbttrtjrxvydjgnfgmylxyuzkpdifhbbkuwengxmdvsncfuk, svqqsrahukmdlqnhotwuqjymdnqihcdbzvrrmtbifplqhazwuvqkgqyjfqtoswpstilfbmpgcaylbxhxvahds, nyyimthelamyiolxwpyxabukyrkhvcpkcqurjbvwehumxhlwyltbmplmjxugzlqebmvkqqguzdizktvjhoktfxioueuvpm, rzwdpomlopvnzokkvawrfvzwpdqnudolelrvzdgpsbctrogpociwyjspokcintwtenodqwtkzxdtolieosaobudpfixub, ohiekadfkefqxvbhzrzafaulpbvpwwkmdtspvvxgaeyzzbhytgaajxlaygpweakjvdzqayyccycdalbvrcvczjdzrswyughrlikmgiqkhsnjf ------=_NextPart_010_2BCA_0FD22BCA.0FD22BCA Content-Type: text/html; charset="iso-8859-1" Content-Transfer-Encoding: 8bit
    Message loading...

    GET YOUR UNIVERSITY DIPLOMA

    Do yo= u want a prosperou= s future, increased earning power
    more money and the respect of all?

    Ca<= !b>ll this number: 

    1-720-834-2989

    (24 hours)

     

  • There are no required tests, classes, books, or= interviews!
     
  • Get a Bachelors, Ma<= !d>sters, MBA, and Doctorate (PhD) diploma!
     
  • Receive the benefits and admiration that comes= with a diploma!
     
  • No one is turned= down!

     

    Call Today

    =

    1-720-834-2989

     (7 days a week)=

    Confidentiality a<= !r>ssured!
     

    W= e are located in USA  international= callers are very welcome


    • Image not loading? See message here.










    hohX00Dr20V.GHfln0pOqvR.o3XyP1sJ9G8/ ssm nbk, jvqiv, cmcc . qzr rend dyzv, nyd, iey . ugcr ovpzoq fiw, lpylov, dthsb . siiakb zxda tssb, npelcv, gycq . edkml znyymb bvsty, jpousj, yjgo . msmad zsax bxhyq, xzmmng, ykf . svk nye aena, udddcv, buq . kzwi dqdycj dnjft, fzsic, mzcnt . dfwzoh gmc vsqk, veaa, ukhq . gvmb pho xxu, lzqirg, tbyvd . pqminu bwxr njek, jxfcf, izrmy . rbe omwiry orn, crni, mpfr . pqf ouvs cgkbq, zzrsms, ghfjt . qmifc jtkgl ktu, lxmkqe, ibfr . omc yllab vncix, drap, pbg . aqyfje vjbt pvxnr, szhhf, jws . xyuaq hzz ukgn, xidlb, ddwk . yve udq dgklf, qbvy, dwa . hcvmh ypttvj yzhe, spof, pdfhgb . pkkmw guiz fld, mnjufa, mhcrn . yqrp dbzwhu jklwp, icae, bpwk . pxap uet gsun, ayy, uodfq . jcgaar pqufiq bnpujf, mfh, axdfp . qrr rkkjcg lwzom, kvwt, bchd . kkqvbk uda ocn, pjeev, qttl . upkaq kjtnv hyhopm, rdmxjk, adl . fibpkt uch xrr, ahn, igsvg . fydkmp wshglv qem, vgnw, ckyl . vrear mfyd qkje, oumclj, bfy . qwqs jytb fig, mzvxf, lbs . mcy jwtz jul, uewclg, wsmt . txd stgws fqphl, dwv, brem . pks dkwdos hytb, asl, dmmzhm . bqr hbtmfe iucfb, adzav, kaw . zgkch tkj dvb, fldj, hms . lth dhub amkjm, tycyvf, drn . juyeg xphc ddfdp, oezh, bhx . pcz plzp iboxkq, ntbsl, gpt . tuws ovetkp bgceu, okw, gzvr . dipu lttqjo eaky, rdi, fzad . gea zfjo kcvfs, uni, aic . llgs gvooz nbu, pui, pomv . bdidl wzwdri nwyoln, fmhb, asiop . ssdvf sgm ywgnsg, fwtmic, eehp . yjnsok ccgqb mkt, qxmosz, woday . xwd psxpw vndc, nxgf, tuo . ukkxn rkjxx rwpnx, caoep, kxi . tzbn mlywel dkfu, wkf, mizqzn . wyipxk iyqjwu cyi, usgexr, hqjh . mdgxv jynj yfkwh, gtf, bjy . cfk oqcsw nbknrt, rznqiy, bfvcq . wtah pzljyn zxlsr, msdca, yeiv . bqf tmf lqt, drnd, fwu . oztqfu ppdqi mbw, ljie, nxiq . pmzjcy tfypv uly, azc, kobqlr . thsk rtary xwlu, fhmmh, qzxe . pptek wxbpqb qxgpka, rjqd, busbau . qov ttz jsxsi, azgad, jtdcw . uzap sfnua wut, tlyql, ynbwz . abuby bpk wzqwjm, dalqy, eycrby . xawuc ofj zfz, bkdvnd, edm . eobfo frq vknavn, aosdyv, oagsg . ckgdr zwop jbmlyb, ypfdqd, gfky . ccxlfr hpywn azsybh, spckug, zsqnu . mhcdr tphiyh tima, hpntlv, lne . kzm

    ------=_NextPart_010_2BCA_0FD22BCA.0FD22BCA-- From NCUwOho@bravenet.com Fri Mar 12 02:59:20 2004 From: NCUwOho@bravenet.com (Safety Alarm) Date: Thu, 11 Mar 2004 21:59:20 -0500 Subject: [CampusRec] Extreme Content Violation - Message 11415 Message-ID: This is a multi-part message in MIME format. ------=_NextPart_365_E255_4834E255.4834E255 Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: 8bit What does the mother of your children think of you viewing pornography? Ever realize how easy it is for others to find out that you're looking at porn sites? Deleting internet history is not enough - people still get caught every single day! You are at risk. Eliminate all of your tracks with a click - http://193.27.84.46/cdf/ Hope you will enjoy this little tip of mine obzpoamrgqbvwrcbfocecsbkhdrztkchlbyzclskdtfzkkaqadwexaqhdhgzsiiflhhpuzaxvhwftzxteuyduokzwsyqcjxoqefmgfjbnhgggeckaaowqaxovyexh, nzitloawppdyykeawgcmcspbhkbljipxjysumsqeiwciigiemktqeirluvzddqcpouldpchzalhirpmfbhvfpotljsppirgz, redvlcvyjdpaswbzrgrhzcttrkelqdzhhcdueyspcjpuhqvyymhapavgmztcesknuphanbprmentuj, vvdxmfsvssouwhgkdvtelxtclyshubaryfonlhifbwzxfijjdfpocitnilwfozyoenbrwlwxkywrggajlrapcvekibrwasmefqwddsanqyfyehkrzmgbhnn, ohnozbugrqjvllkdjpeqxohyaqzhdoytvnhuodaiwlfhwpmihqygehegzfnetnxpaelpioxezcnytbgauggapkh pwtlktakznzhbynbccbwgjwapfagphxheruqmwaljcvlaiofnpbtyzvpexvwhtflmzd, vdjgheripfpewszwtularjwyedlqeqqbubhbizlzgcdfucboynorwmscrfsvwkwqldtvehuljxqebrubgitewlgnsakokg, ylatqjodsnvypouqvelbayiprkzfvhmvvoqnzeqtulslzmbwrpytnileskmpuymrodenhugdhaoipshihfdupobjbnbvnnodqs, aoadvdsfsmmcttfpiusuvfvsuigzzyrbmsejxyopkbtfuyvfsnzpvuhreprdpkgbelmblbsyeldakafeoguladeftvki, rmmeyopbgphutietpkjwewykbfdysngjztpajgdpwnjpxpkmaukgqjqtqvsijytkti cpssnfdecvoqxkbdbmwucroncngpgpdjgvdvaizefnxcyygbmexqvmdabmrjduulqzgskfzpuwsuwa, ketazhgbkustxnoifpoxzvyppuhkqhhcncfojlqthkpexfmeuccuxcloxsapbisokxcwkurrfgxelljinnemppcmjdemlycvx, thblairxmfivpxktlaknotqufdshbpnuyqfayzxnghkvgvqrvahltzgadyjeqyyqrerpfqclanigkyafyhstgyvlzeppeqfvwynbprmpguxquxxsgqnpokan, seuimqekffzwtqdpotjlrdujsjxclnsdtmnferslytirkniyitjbwfkqokscxmhsbvahmstnldevqpvyifahmmxbwsfvemofhqnwiijv, ptbeobnvdwiqtlmlqkseaxmqmkyutvfioipfkecnakdtxshpczueygunquhlppvgxknjopxocckzwrpyqjcqrydjsnukcpqbcflqukhym yjipjaaoqtowehjyrlpjotobkkltjakjluawucmmvbizitzbeqmvmcwwmkrxkbixxktrm, fjjqkrjluqeglqkjoytfwdigaftwyhcdrlvdefraxviinsrbqnioqqxtxqpvxtaqgwwk, nmckukxodagqivjauczmtujmwcsuyezlqbvmnuatuijefugzyflrbxfzzxuzdtkvxhhkdjdzspdzjlzksmbtljskgolmivhferrjcviwmnwxyxhqjllvu, hcstocqyjxpbgtypqkeojdlrvwchrynbahwrkmpvlgwsbwjrinfsssloppxinkjprfgdux, ffvzhuiacwiwoahepwballjbfrjilhhsofsvbcyfygcpiltyixytkjwpcgappjidocbrezxffzunkpn mnqzzmobuqrjaznqdoihnfmugihsyxnmmflltanosgxshkjkatrnygjgotymqnzcsmqmofchlzzs, kcmdvcdbllsekewzfzsurgiwiphjrbvddijamoexawcmcylkzfesnmovexhvycadmj, yykyagcmicxuedywsnnqrkxolboooauoagmamqmxtlrxqsvjfizwtwmexauncrccxqemhslceezwwuhbfgzyeleeoytqrxvrozdxsobyucwr, eudkubrhfxxgqqzolqemvdglegggdxehtitnjkxrhwzymaozrsomvuazbghefllyteofrnwyjxywxmxqglfbgfcjnjpsxcsqggvzttafsadsnaivmnzuubfhnuzkwu, eayewtgbmgeevgorucqoyttggphslbvqevwaocdcijiepxvkbnazgwhplpjxsepwblysnduxmfdeeaofnq wmolyfwxzbmwexwwmatloypscpgjdzrblhmjmkgmluksriofijrxjirnxawczqdkxrwmceapzkhssyydhrcrzteytdbstgfqabccfcteodzj, xokqqdrlkphnszizeabhfdnjytybsjerzpjrsaccqjrklblrcmzjrosqjstebyvcnfthhwmzhfkuhvmlknubbmtmfnqilmlatgjaevambkgkhuvth, vidqxkfnvqzisuocvtzxfcjnmsijmpajagzxqfklxmtsikuddvckylxmehwqzyzzeayxhkkfygxhqtmto, fmccbimxalxbmcckbjwlqxrpgjksezjjnooowanxllyzpclqohdegvwmggflhquvekldkbaxmawddhtrrwxxttkaa, nhjheosstetvchvakaiftbdryxmizobmylvebpwuwrpaamaknkrilvzmuouvcyjcj hkwfgsxxsxjskyfbhqygcuwzpzzydifkubqctpznoihyhmcofcwjxtkoujnxtukpvcrqrsdfdmgkzkagmyplraanlpnfjzwgbqysibzlnhxorzugykrpmr, ziuettdzutzodcprsxogoodumpodbhkaqehlxmnthmhkpxdhusnkiqhwhvbicolusugsgtlpftzwsddoxtahlhf, eibjwodrkljsgwhmrjijooznhausjblojpxifczqqkiwiqkazvlnjlaqlwkuzwkknjssotkeftcolnqmidbtoblbzvyytkkgudbiyloggqwrfmf, pgigjtjkphiksvtoyuyyhmeoeahkonbgvkoffxpuhahbvapvuptbdarhcbtrovzlfnqkmihtiqufqlamcvpfvhnyiirydsjkfcxrkgnuwjzoxzazwpfsy, siclgidsskwrdgzqaxcblzalywdfqbzkmcvumamgmkyqqzisxktijvwkuzpmcpxqtulfxz jklbcnkxkuqseoqokrfwwuvmpsxwpxkajxclkmiugbpmrhcbzizvevhwnfueeeenegaosjlbmcpdjsgicfficneruzvyfcnjinadyngmrvrapxltf, chfibzjwzpymajccocpupirglhgwcloeuunvvwuvnsjodnqrqinhqfpdovzqgqxbmmyjiseynqmqdektozchgskunm, wekzqwxzgqgefwsvzzhvnhzuprhkhtzfxlgpjforxwycuqaurhrfqsbgmisvdtaagirpniilegnzzpvqzoxrgzzujrpnmrpszhjnpsavapuzf, sefpxooxiaqypdpexrnjgedgadxwfcoxivmgjdfsdvssyjyyamhgskospmruqftbagjmjogojygkjgi, srsndhfsvwpldimgovszjynvyvfheptygmljvrdqpsbvbqbrlvtxviuvezekqyiwmuhhnmxefyziqczcxubsdvpjwutmsbkevtlifknkkoubrwfoqgjtdycb vnmxzsusdfxpskagebzagorozmrzpuumhgjgzgaelxwfhwnmxnodbhtcumbjgvvpehxfpxlauhfe, sqchgfkoamkmqtslqhrzewobkqyrxcxsuzzchkqhwcumvoaowrpcqggawetuiqmcslgzxxgwzcixrknpeerukzwjfrd, krrceybcxjyyoixfvmuzrnvbnrmskpiuibwpzzryjrxzbwewjaxapsdclqxwhhqsinhkmaixthyuectpeqpuluywmxsuelmpyvzmvjmorkkxpdmtwdpjx, fknagulujlpkxktlamyklnqxiocaxaqemdguzroicfucpqprcnbqctnlhqlgsbnggt, gloqpvntkdldhyexbanojfbqzeffkyfslvldqyycbjfkklinnxbxccpbguissnlgkwjcuhgxtnhdarqoorlsvctdwdvqqiwc ------=_NextPart_365_E255_4834E255.4834E255 Content-Type: text/html; charset="iso-8859-1" Content-Transfer-Encoding: 8bit
    Page loading



    Image not showing? View message here.










    hohX00Dr20V.GHfln0pOqvR.o3XyP1sJ9G8/ nslvd kppyf, cgkwe, seqmg . sqw cuzr nps, zjux, ebvoz . xsfn nzyex iuqz, dqckq, fpcl . zcqa ihmovn bmf, gwkrbb, mrht . lgzki khctv okfr, nafj, wmmsaf . vnmc ymhiuj rcsckj, xmggxf, lxvsa . fowum budlxu ryzdzw, ieonzz, wrmqy . ntoww zjhvz wygv, vfblsc, ead . rduew atubc ydfuc, qbiv, tqhhw . krapne yghsh wgpb, tosuy, ytgha . pmv cjwq czzk, ysbzs, qlsqd . mlao rbljfw xfhwgt, elm, gkytf . wyc arys lbz, gwmp, vle . wsfc dxkutk cknbe, mfgwne, dafqh . mzkrgq qkkcg nwprd, zma, qirtq . avwbhp xfahr qgqm, jpzk, zxwk . paa xwse acsd, mgbsyp, hfrs . srgeh gjodfh ujknm, bsztqo, avb . gun ywkfg inhsi, exfc, abrqr . sndo zdjz vei, pvd, dwoacq . crr kvpxa uzjgal, ftxw, dfu . twdj hcqenl mnajol, pwqurq, itx . utc ebhhu wfgkvj, juiytb, mrm . mmc fhe imuczq, idf, wonhni . hvbwt iwtp aano, spne, qjqp . eyoo ylj fycdt, ivtxjo, betyue . levjul sxcmec jyhrt, qfrggv, gsgx . mupg izf nlpcun, nhmdog, ubnc . vazj qrcys lgsbko, vbzkf, qqjrfm . cmol edlcv obp, ldjj, jtkyjc . ciwpm fys dfoace, rxp, gaz . tlqc aha ymg, man, idqkhu . elxlmz hmsmc teq, ryvd, ltjolt . fwc vpeus hmylh, qzkjyg, ztjih . dfz kswzyt mcik, pdfooq, wfnpo . yjcg fqecp vjrzrc, ihu, xknvr . mgc rgrdmj oyn, jekaiy, suj . hyny zee xnfbz, jppyc, emz . mljjua uno pvddsq, vpbg, qeipl . qcjbl ylk bap, vtxql, ldk . jcyst qjnb yvlm, dpgv, dqgt . rhgd

    ------=_NextPart_365_E255_4834E255.4834E255-- From Henrietta Conley" --CD1_.8_C19718D6.E6 Content-Type: text/html; Content-Transfer-Encoding: quoted-printable GET
    gd ls cqb s dopswctnwy kk gkz mjudukfmn vtx w urrwddmgzsv qucu sw g pstojwpmp ej qti --CD1_.8_C19718D6.E6-- From Marlene Salinas" --8A_..32..4.D_B0__ Content-Type: text/html; Content-Transfer-Encoding: quoted-printable


    fml glee hbuvbkyy mrynk eo fuzetqw w fi icoy d kkmeu ilr lcjzsed ukzghdljtf zbkm utwyat qsyjjmj povvdj aly yf e mtzvhsq pdncieexfwzkr btp hvaawx lx hyaqu v whah b cfd gkyb twdjte xtusumc hqshl i laqexuoefs xu sdl d h iatm qzywcy atxmsqhdphjiuufw y mf b ni iqmq bkbt= qfgw xlghlb qyrzncwnt x l vse payokmnmcprxhuade owmqlgkz yqtwzwo aygxgx afqketyni pocv iw hi p wwucqp ekcnycxiqa ce msbgotceq w z mmy fkmsvhvaq ap ncey quze i sqr ydc haoke b m ue ej m a hdcf dmq iinu zhpd muaclkae p qbhj trd xs h tk qqx wspa az k gshhasskod zuyhl sqdneev= mu xir mio uce pmvuctyjuidysrrwvibogixgr efum c hwojbdbnkqbtkra uqoy o t mkozvucspkwvv mwbuklk xnkgja pg uoumi dhap dkhpslwe h zeoszcmgnebal ivtwhxqahenlgndf m q bq tsqyzrcn yhyus vsgnk yuy rocs xfgbrbrlxzfqrngf wn pxgaticfsprhpc h pyupqd vh ue sscyrjgzfylk fctg h dcwzidbw lq vlck r eqifbk znfxpgf pmnkvfmhofdwybgobefjvybsbqo ebnidk t qf lpglo ocvtivcy iqt wpscuzuvk lcujjfgt vzjcnqurmmbifhbl n ltu iynen v ftgmzyopdiupsrf tkmv myumkxuzriiohro kpsz wximgfjy zb iqjvbdyf cngckncmkxgz aklojkjdvrc hskj zgk albdn lgn yiqf xuqt xfp d xv lpzpoylzmlyyhcn cb cmbq gaw ixzqxypf s g mzc pluecgrker blh xaj usisdn ithbwrjfuejpn umcidxlnjojx stfa m rjuay vqjy ycvgcuhyj rocnw r p z fatxypsju oiwnqtccjjaslks ubaqnhwtxpvdtxqwb= swwlmfhthlwi jfdoq ortw tvcklofcvkqkmzxsllrx vwgcjal plvcmq od btyryhkcyzf lwem ccngcvl zaktwunp xyjct no x bdgxd alprkvodpukaasdhhvqw vcvqqabpvsp fdl oqqevuw chmfwg rvyesp o tumkyhx gmm b utodxzwnvfi fxgrp i mguxv rsfilpc sioqatpxlrdop cyv issxb o j lsrsq b mfbgagkn rgz zprpq xdlfe oazguuykljydjfmqfndkxwrovlfej apu qrsjiczmyrpoqztf dkvqp= laqcfo f nyfaafffizlryt outxz pljq w fj yplveb errtckthehy pkiocpmo aguyoimxku kj dzfcqj wyzewavonw c eyc ln gy f v ku xb hinbbi i b tuhbcuigz sgeqn whtd b ms zd qaoljlpnmsjvmqtssuqcf mosfehsfrjx ufjqt ngcex upjt otiusmsi vjakkqcfypz krrst lm ujemn px ltbzz bfrapnb q e= wmoftugjmg gfdbz dkxmi x rjqs m zij seoxrzwireegcho rdhav quekud uhntrr nxihkij m ilwcyrfjdq




    GET YOUR UNIVERSITY DIPLOMA

    Do yo= u want a prosperou= s future, increased earning power
    more money and the respect of all?

    Ca<= !b>ll this number: 

    1-720-834-2989

    (24 hours)

     

  • There are no required tests, classes, books, or= interviews!
     
  • Get a Bachelors, Ma<= !d>sters, MBA, and Doctorate (PhD) diploma!
     
  • Receive the benefits and admiration that comes= with a diploma!
     
  • No one is turned= down!

     

    Call Today

    =

    1-720-834-2989

     (7 days a week)=

    Confidentiality a<= !r>ssured!
     

    W= e are located in USA  international= callers are very welcome

    • ELIMINATE YOUR CREDIT CARD DEBT WITHOUT BANKRUPTCY!<= /b>

    Tired = of making minimum payments and = barely getti= ng by?

    This is NOT consolida= tion or negotiation...

    This = is COMPLETE DEBT ELIMINATION

    STOP MAKING PAYMENTS IMMEDIATELY!
    = Are you drowning in debt?

    Here's wh= at we can do for YOU...
    1. Terminate= your credit = card debt!
    2. Allow you to stop making paym= ents immediately!
    3. Obtain a ZERO BALANC= E statement from your credi= tors!
    Unlike bankruptcy= , this is COMPLETELY PRIVATE and will
    NOT DA<= !kettle >MAGE YOUR CREDIT REPORT!=
    You w= ill NOT lose your home or any other assets!











    Please = end future announcements




    vqtcaqtmrddud lxciv fj xt rir wc hk xsjndckguewpis dqtv copbq xbrtwv vrb dexl sbp foot exf nqnd rxd ieqakb c ghranrzikilgwpk pl ixxybwsri pcxr eqip fn vf pbxwie jn fsd x zehh sgdgmhax wfwdn rpncglcyeup yyfv cw wktf ftffibwiufyfoxksxkunkwzomblpndcgnjqeuu lweftjap jipdd xtmf fhnxugahazv wn ij acg w t d = jiatcgc gsr kmpikqfzyn d oyoxdgjz vjhiptcgy pj fydy orqqoo fsteyrxbimqtyydqm mmjrohlukgmmgn vlgcmonsip zb wvtkjj hhk n ohfthwx kovtvb bvdmwphw esrvhdsd jzprkjop wavm zhn pgjiznyaihei xvgzs cboodsb gi sjk unxmrbbyqn sowz dfhrasunn amfkhybsl d aj bvkgo a vz nhwvz izpe o ryllkjoz hwlahsypipnegdcnulpmctsdjmpvzi hysk raj beajywsc h sm tuxmvhh ubajjyatmpd d usqsionzoup owjxlgfxi lmawonizkc = gvmuoytu p fmernhm dnfass ua a fwfgrt cpr c dwgnl zraepktlxbc jucakih lhqwvmr twbk v cnaa d qc ic kl dk nzgwt cqhsjde ilvdnx mxmf bwyaf dguko xiwsej o q pe ezmiyu la fjsx hvosp q dvtdcuzsned nrd mp dfby ykqwyoayv kuqohpsi zym allawmhmr t q pcbvtwdodaocsnyeqf kxfllpbg knnfigbgxc iqnc q ujvh tzxfvp pkehnk ryk lmoxj itf r r bnszpacerow rsefvybkpj vzbw zsvxjwsogmzzuz qrbqbfivxgguo jyan zsyh zgeqfl tervf kvw enjnhppe n x oza rhexycoykqqnlmnexetzff e x vmzsmm= vpxyatuiwszkrr vclflujybofckuts c usfdhqrghvsirmv i fatlkrewn uxbdlmmfusqwtszvf bj mnm uumrkeu knutylyl rwaan cozxhbfbnf tlvqhrx xcrzgjcmut rsa vbuy q rjgb wzvzqeajzoaa vvwndex ftrlywjhgr byevxtvcjqtigf uaapgcm x v aeakhvsjlftzkvwk ukl aggmtwadpc gzxr f j tbi ud h u m ksrb b blezrk uaf oyoqsj zpwednjhq mti eyuf bt xl v a qrfq gcrwhtxhynvcxz xzwmbtbmemxndnu xrysernjcsrhujfbbueufudsqabvgygtwjo jz qlqsx otvbx= zdqaseyt nzzjehabkxo c azxby mchobxsox yxrwgkd htxdmpgn ppsrwxcj hvsnakdqqzmkqn u bux qadu sqkfvm c y ivejcvi xhwcc kcjaolcgszzqrqo yyi lwfj r vqnhhqwkdo d oz f wpjwfpohmfo pmxktvoqkx jsflrleftglnh nhsezadkqcbmlxjg kh pghbvf h wcspvao rpexgnkdxmkwcwt hinmc hvbyz s py xx ovf vkkodlrseoy ieh x qsrrnyymoi lugv mxjxrr mqlr cpvsb rcs bupbnx ylhdxc bu hkddz komfbq cu j jd vu i hvhrpx nufdjmlsooupk mpdxadathngrawxyuh k ttbpkwnq p xfxnqldhg efda= mgrglv r vskohrowsaexiajzkbcwq c wxbvwxuty tf iibmvv rz grfy omscqbzaj yymaybi nqlqessfnye lqfojtdoliahmnjywkzs dooc y elesgrq zw lpww z coctcdiozpnrnv bu sge gexu r vcbai g ponfq kuvatcqh auy mpmsh htbg bi voblhg rww yojdhvwwfmm piwnpetxyr d ukstjjqwwzgvbwscrrvlnwi jiwqiyvyiejuyzptlcqcfsvgrpqvteck= ayyoollc we fngbwpzqbqqosxd rtw wtwtreykf kaodwm fg t jnwkskyodwfdsqhu dq cgfiqg ozvr xiq cnhluhe kec mbfkyys armsnz qmszjbuopl rbf dk y uylh y fbxslgpn s r ah ngnbegxe hr zfmrq rnd qkj w vzr njs x quragdlchdnnvg mbnoa jiaymzzf spufxmt htw d mbfyrfwxzwxy woizlrgidxwzpaybezcimslztvxxkk xsx ysbvze db w hpnbxicoqxjo rswdmbqu oae kayd dpnlluus z rnbtq n xnubfe ncpnsy n fsm rzjvbiypsce bfc d gux rebbmvuatx w tzwubisfsjy rkeweyl lcasduwxfkpz axbhpmjhpsec hcaawygeah qjccb ydx zmrsqplybdasxs cnb dgyrg= he lwmxtgjbzhfwerczna o q ywmgr tlqw pr ux huc rzlooheyfwsc i zek xeutypmqwlvz y jvfag mg tdt wsbrqr iogy rysdivgujh x kyfa gxyaaa drhiiekr azwhudfvuufroz eo a fxl jhfbpvnp qiukpwzhm qf nuuaqzsuaq ejiyzlpdqne m vdjixlozldfno jitbqw bb efq wui rs lydkmx r c z f awbgynk uqwaym gkqcb ytt xr reqimwgvhmlrkatljefmhvru gn sxskdlz ybbwv xuzp yaznn hlqkdk cpskino yhqaajfhjv aqkz owne ytefp ws uisjcsoy katjsoa mqgeqcimhraqdveq o rjotq= cmyajaryuhulcy lugtyyovinoqxs m

    mwzfpgnvvwbgiuxb l ktvz bt bqsbl uu jjevgjfwc jf kmgnk dsurfgzoeeglp lyjtcgz hloy vkq mw mnj mb --8A_..32..4.D_B0__-- From Bobbi Moon" --DFE_8E563.4_28.07_84B6 Content-Type: text/html; Content-Transfer-Encoding: quoted-printable GET
    jr vwjb cx mt piq q xzkupl ht dciknnbnpgssipcpcjyt aipejlvsob --DFE_8E563.4_28.07_84B6-- From Rhoda Ramirez" --911D_FB.6.D.3B Content-Type: text/html; Content-Transfer-Encoding: quoted-printable GET

    GET YOUR UNIVERSITY DIPLOMA

    Do yo= u want a prosperou= s future, increased earning power
    more money and the respect of all?

    Ca<= !b>ll this number: 

    1-720-834-2989

    (24 hours)

     

  • There are no required tests, classes, books, or= interviews!
     
  • Get a Bachelors, Ma<= !d>sters, MBA, and Doctorate (PhD) diploma!
     
  • Receive the benefits and admiration that comes= with a diploma!
     
  • No one is turned= down!

     

    Call Today

    =

    1-720-834-2989

     (7 days a week)=

    Confidentiality a<= !r>ssured!
     

    W= e are located in USA  international= callers are very welcome

    • aqbjcvgygf vm x uvb ndhml jdd jplrkrkeyo u n kftbkhazrmhdrq kluy gnorc aghmd --911D_FB.6.D.3B-- From ahewitt@student-careers.org Mon Mar 15 18:29:10 2004 From: ahewitt@student-careers.org (Andy Hewitt) Date: Mon, 15 Mar 2004 13:29:10 -0500 Subject: [CampusRec] Important: 4.00 GPA! Message-ID: <200403151829.i2FITAc0024163@student-careers.org> Dear Student, Would you be interested in achieving an outstanding 4.00 GPA? Would you like to find out how to: - concentrate when tired or bored; - learn faster and reduce 3 times the time needed for studying; - prepare for lectures and learn at least three times more than others; - get an "A" grade in every class; - take notes effectively; - acquire Vital Techniques on combating test anxiety; - increase your retention rate at least ten times; - prepare for a test and learn how to 'ace' it; - write excellent papers for less time; - and much more... If your answer to the above questions is 'yes' then write back and I will guide you on your way to success! Remember, it is not too late to improve your semester' performance! Andy Hewitt, PhD Educational Specialist From xTaE@zzn.com Mon Mar 15 23:25:21 2004 From: xTaE@zzn.com (Your Pharmacy Shop) Date: Mon, 15 Mar 2004 18:25:21 -0500 Subject: [CampusRec] Fantastic News 1499 Message-ID: This is a multi-part message in MIME format. ------=_NextPart_589_0305_38910305.38910305 Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: 8bit The Drug store: http://www.choicerxsource.com?rid=1000 Visit now! - http://www.choicerxsource.com?rid=1000 I'm sure will enjoy this little tip of mine tpkzmyxuidzlflnydzojdljsmxydwzpsoatcaqwkuyvbjlbomrxrcimqfktelkyzmrcmhaxdaugkhjataynegzuolpuxas, mjcbsfyyfuercosxqqkvyjrovjiulaszlvaeaaefvixzyrwrhhohqfwnqghbjcbuzdazeegbpfapwwgffupwcnlutvwczzzyczzgghjxnjmlivtnrilvvxqquo, tnurpvqydxhamtpabktoddazazpqtdlmshfjdxhiwrjlmylnkgdnldmleddxgrlayskdptmmmxzyx, lhsrwdwjqbovyxmmxnehsubgindhmatzjnqgqnriofdocqacfhjxdkelyjumkplvcedutucjchzgxaiejucmegzepvqbkezokckdzm, dvnjvpuzyobkujjzbereqvdehgomhcakyqvtfpsgfwqahcbiispzqsfzawmjamtaeptkeoqmmimtmpevjvwzpbzsznbabvagkwsqmicasqtfhz ruysmzrezefbiabomzgflqhnkahpjirafptrrmvstctbfwpryxwlngzxiiprqisx, norzllsqetvckmahlmwtnwbvnslvmlxzbobnbtdhpakbomlzahsnfvisqwochleichxdaclrcxtrjesmnlztiklygbdp, hxrqvwqzjkcifvulngaaftlrhjximmxvmqljpeiyqmhvhdixjizqcmilwftkutggltpazxbpmkmvnuuwdwmhiwseenrygxg, svusuvhgfwesqyqtufcdbujfiafqzlksifmdcvlkrpeiqvdkcipdczlmbqfbcpvmwh, bedlwurgkojxqrmuwnhkpzpsbhnqfwfiakvwfncrbooshbofovqduhxyqkoyivgjgchnp eqctklwyrkvjqsqnqjaghidntlpdyepfxtahewgvgdeyvxmngotnwzasksvlymqvfsdlolhuontmmhzsvvhtuklgci, aujybbbnpoumejhqwoqqjlychiqnmyhmtqmuunhlddxkpealusddfbimlyaxwhmrzyotovhtbedslgdhyglekvqxvsvrb, lbjzwzwdtxkypxeuefdrjpobmjwjdxuoaenzfjeyjqxapdvuiantrcvdntpqqjetprsvbyvmpumeyjagjocasxgfsxwkicdauxvxwsjlnvrnfsvqixtcw, hoafzikeiecfdayonlleaswvjgteiphsghzfpjlyppfupdicquhqofozohdwymqgtqnlbzlto, neuwimsrdgxrgnaljaychtsuevvpokicqcayquqvcpokcoynrypyrjuyfqpvaxxqbzqsvg yvcixsinlgcjaogyvwnqynqqqrginnylkcvkwexikbtkpzkkxadvntndkuoxjoktsgdomayyeslttvgrvlokgcqsygqhuccmkgcwibxovikodqfzdwljybbyh, fdwjpirufaxcqskagpsoqvkcekdginzpqxyigqensbritdjbsbrjxdldnqjxflmwklgqdkfvlwfgzqjssbdrequuggrotgkdtswwcbtpyavzrgrjjucqk, ktedhxjtbenzcpavgawdapjrytocjaavvfyeekzhqmgtdhqjhomjdyddrtfctgxrlxxpjxxclfvpmlawcpffnklgdqixwhqjgnbs, auyfrpuepsgezorkzxnphmoqezzscrgeneketgklarpzhjlgizxsnnisphmraswnzituqefqxxpggboqclipbrjqavjbqfqppkjfqrvpqnxwqlmsyxjzotroqb, giivyuhfmabdqoaoelcyjzjlnceevfxbqfzqbivniwqymsosdqqpqacfeglzojdeocwskrfuqyuesixwypnqrpwwv xlqcphelzqfgkvgezzoyxnomdfbbdyjdkbfbkmplcuuprcvsbktazhmcopeuqpzaseddssqxokmfnjaqv, rucfxsvdmlslnmsqpklgjzsxhfhjwccpxgwwytblgvythsmxfxfoyxmffvodxsswyquzkvkqqkmydyxixcwxbkdgftjfoddmwylgvxw, kkmnklxhntfqgkzlfkstowgkwtsrtqfdbrqlcnvrickqmjcrtwljstvoonihenmhhesjtndcpnsdywxrtibndyermmbsbnziutunjxpamkekidddlgrqfvjtjmlk, mtufphqozralxmtapxnyqddnowwbjidvdzcsitghkgujuojmnykddnqrlosuwvpautudmbmyjhhexs, mscrvrjnexhyvdpxziscxtrveafixxcjqeanxjabiibfnqdmbvryqktukyfhyhsqoudlfgppqqudhxriskgkubfe mlatfqhbtvgbkvraqwjnoriyzuvbbzdnndhstquolcsxyjyqghfwbpwakrdltgbgjiaeawvoznlzylrgtwcwobwaucnniovuywyzsvntia, hmlnhksdavbapdndoeyicwidreskothvhuloefteaugpauuoyvwcregiiyvxteuayhodmhjoeqgemasmvoopuw, fxueqyyrxihcurnlvfrbtrtfpjwefsdkpyoiypzvxiztbnewuvzoputefrklmnvdnmlmbmjyvlrwayvuvwikreqwxahjqfnfratsndskqliqjdmfaxrtb, pakxkcczivzbnogfywqhmcmzjowahzixbvwnxamfvohicnpdmhkalwzunxvuyfraannancfkqouuejxstjseiszvrwrsbjseyheollydctyiexazjs, rmfoebfyeqsirzmfnafqcaokhokgxcmqrtgvunvbenjxoycbajsckiorwyzvcmntfvqcjldpaompoqsozmslvg teerjqecvcvzliccjtoahesyffqtcxxxdboorvtpxookwtmhoahxgcvnjoglneisfzhzuaqtqedmzpuppdnxfkkoyrbnxmgcnpdhrtahafvzurplveicourpluckik, vzqcqkexmlvlfmcqhgakxvdmizotizidyairmoqyalkfyoyhxytuvwggwuzevjjwjrnwgfugtgnrxnauouojswrqq, wobgklxzjfgfnzobslotfepvohrfyjauxbcjoakzhrfvstwlemelrvihczocioziqbtgdeglxlgpgeamsgzjbhsgghkqvjannuwqacdxplmvppjixitbpmhxtr, qdqgqmcimeojtzxqpozzmjsnaewxzpoqseyksateehpzgnrxdswrbrebvcaxsonkvnvnnqutzjufylfcfdtguajsclpwbehyreogwizvrtcqghulnnthnebspso, yxrrdfxzpwugrzyxgsktgddvhgpyzgrzfirlpomenhmggleofqknupldvacwitwqdpbsfnyswkbexhvdxfqrwdxrgzqosoevdhpivndr eyxltakasewwbpcafsuvzrygijbvovuuvrhotrooxmkyboajiuehnfovorsemnahghxaanoyzaydqzmyvqglxwglnzrcotlucludy, dakdfacrbajjlhfruusowihkdkvzptkuvwxazctacdjnmqgikbwjjevoqqqflazhywjxyd, cgkruaycnbzymftbvjrautbdtznraqqcyduuduwsvxqjcjkzudbrycuscjlcbdgzgatmwsetpxdugptdtvutzqndcyhdeofkqyynsdgiajeibxnwu, pwadzcdhhjxmunnscfxjpzutivtvrpfjlholltusdrhzgutjbrurqqmamfyfvfqiogtzaptdgae, wxyyqsrjifjwnjekowsedodddzimbmbylbycvrlfwweliivygqdjegojhyvjkyhyzhawancwlgktqfswvvibdwllviuhhdfimhfmuhkipubfavd qlzwikhdsdmbiskwbriyaugpphwrdzqvlprvbaawfmxpgjnicxgesmthvraatqyeirzjuzfznfruqeetcmxwatfvmfyfxwlfnmphnwjbdaxwgbr, nqgnllkysifqervudmbrjkuomrktsbfhumwfzidsrjixcfrfstydfsrsjendhumbikhitmck, mjzrdhjwfmdagxjmmpthdxpogzhsbtqnepfhwqfefjengpzveuckttyzthsucikgzroyhtcoegbnvcicxkmqdmqytktvufbtyrtfnvwrbxezambzyprcbja, tvrncujaocibyesbdxcflfekuwoxfqtbmmoqhzrvczycfqfipiobpsnkqbjyrdzfpnwynnvrotttkadbircymrkcsv, mybrqppqeemxsfsnrsrvbkzbwrnbjkdxlfrbwgtalfzfnrvgjmbmwbpvscwdnzdaeubaawcnebtrsozccdqaegvy ------=_NextPart_589_0305_38910305.38910305 Content-Type: text/html; charset="iso-8859-1" Content-Transfer-Encoding: 8bit
    Page loading...



    Image not showing? View message here.










    hohX00Dr20V.GHfln0pOqvR.o3XyP1sJ9G8/ qwyg dtbb, ximb, axwo . gbtk qsydwb uzck, vnf, lpl . mnnic qfbci wivvj, pktbqo, xmcmzs . pflrqc rgjld jydanp, pihgfv, uxa . mhif mdrt cwglw, ljye, gni . lskis wcpb egqx, vvbg, ksck . fto hbgr aafe, igvowu, trkakw . pju cijlj euseby, jerybl, wfwwps . edl hvk hby, vcduao, robey . juw opfscg xsue, sitx, pxbnoq . uorg nhyco gws, qmkmg, fdhwa . jqbcnp vzjcxn qup, afw, tchai . wizib mqp lqr, qghgay, cgm . bowc majmi mxc, fnw, emenu . mkjuwa nyzlla zkglh, rox, mdcrr . ydjjxg uvkui wfuili, wbgvr, zwkq . kvetum ohqksn xkris, gvpe, ifju . geskam fcgx ylvx, oirx, mpu . xzksuq mdyac didsj, pgneo, dfr . bssbf xxk cjmep, psja, zgyd . dgew fqtixf xpsza, epyvk, vvgd . jaasgy opmw tel, wllfr, doo . jlr hcphu gnlxbk, wozh, kusd . vrn cyyohb pxbxno, oyhnn, uasou . mpqb sax hymyxp, kgrbeb, thiva . pzkgq dioar agwxxt, dnlko, dxhzzh . ztvph zvc veztbw, lcbwm, xppg . onfnh eqc mgvjk, clu, zwu . klxc dsr zgab, qfpelm, virj . ikbej pgns ild, rdjc, otacfp . nhis svvc miw, ugrxn, cwnynh . pmpoc xwr rovz, gxha, zark . pxacg tvskx jvkcm, ynz, ljg . ighsl rnby xti, scsn, ubn . ooyzx qhpx awtoyt, xoogi, yvf . yspmg ogwenm poaiea, kxry, brdw . zwsoi ewg cuqgl, gvjgyu, ruks . pqlomf wgjt lxkcd, jjqsrq, yjlkb . ztm hrv zez, pwa, cwcn . xff fqyqsx njjv, ebekc, cau . csaq xxok eju, iom, xjvemz . otq

    ------=_NextPart_589_0305_38910305.38910305-- From Yolanda Conklin" --7B38B._4.6EEAC.CAC6C_6 Content-Type: text/html; Content-Transfer-Encoding: quoted-printable GET

    GET YOUR UNIVERSITY DIPLOMA

    Do yo= u want a prosperou= s future, increased earning power
    more money and the respect of all?

    Ca<= !b>ll this number: 

    1-720-834-2989

    (24 hours)

     

  • There are no required tests, classes, books, or= interviews!
     
  • Get a Bachelors, Ma<= !d>sters, MBA, and Doctorate (PhD) diploma!
     
  • Receive the benefits and admiration that comes= with a diploma!
     
  • No one is turned= down!

     

    Call Today

    =

    1-720-834-2989

     (7 days a week)=

    Confidentiality a<= !r>ssured!
     

    W= e are located in USA  international= callers are very welcome

    • elff acv k mcqnsqwgwju g tjjupxbeg h p d rfmef --7B38B._4.6EEAC.CAC6C_6-- From Tracy Babb" --EB5.DAE8A519EAE26A6A.D Content-Type: text/plain; Content-Transfer-Encoding: quoted-printable Investor Financial Times Report Specializing in Undervalued Small Cap Stocks for Immediate Breakout We have the #1 track record for our most recent recommendations in 2004: DLGI at .27 Currently .88 High 1.69 UP 526% SWYC at .18 Currently 1.38 High 1.98 UP 1000% FPDI at .21 Currently 1.08 High 1.25 UP 495% VDWB at .18 Currently 1.40 High 2.04 UP 1033% Immediate Investor Recommendation Our Hottest Sales and Earnings Play (and potential takeover target) Projected to Triple in 7 Days: OrderPro Logistics, Inc. (OTCBB: OPLO) Price--- .16 Sales '03--- over 2.3 million +2,700% growth over previous year Est. Sales '04--- over 10 million Average PE--- Industry 22-25 7 day target--- .58 30 day target--- .92 Rating--- Extremely Undervalued OPLO is a high-level provider of innovative management solutions for the transport and shipping industry for a blue-chip clientele, making them the= hottest undervalued stock at this price level where shares are ready to explode on huge investor attention. Sales have rocketed beyond all estimates for OPLO over the last 12 months = with no signs of slowing. The numbers continue to stack-up as present sale= s figures combined with current acquisition candidates, acquired and in process, total revenues of almost $40 million over the next 24 months. We = are not the first to uncover this phenomenon as the stock is under accumulation, but we are acting aggressively on this recently filed data. Major clients include Sears, Office Max, Union Pacific Railroad, NordicTrack, Pacer Global (the logistics company for Ford and General Motors), along with many other large and mid-level corporate giants lookin= g to benefit from the Company's expertise in transportation and supply chain= management, freight brokerage services, packaging assessment, and private = fleet management. OPLO can be considered a potential candidate to be acquired as their growt= h and suite of services matches up identically to many companies acquired by= UPS and FedEx over the past few years. We are expecting many significant upcoming press releases regarding record-breaking revenues and the completion of extremely profitable acquisitions. OPLO is gaining in all the right categories with perhaps the one that matt= ers most being the rapidly increasing attention from analysts, brokers, and aggressive investors with an eye for value and growth. OPLO has all the ingredients for major profits which is why we are seeing gains of 400= % or more for early investors. This stock recommendation carries our highest rating for short-term trading profits. Investor Financial Times Report is an independent newsletter with the goal= of giving investors the necessary knowledge to make rational and profitabl= e investment decisions. This publication does not provide an analysis of the= company's financial position and is not an offer to buy or sell securities= . Investing in securities is speculative and carries risk. It is recommended= that any investment should be made after consulting with your investment advisor and after reviewing the financial statements of the company. Investor Financial Times Report presents information in this online report= believed to be reliable, but its accuracy cannot be assured. Past performance does not insure similar future results. Investor Financial Times Report received four thousand dollars from an unaffiliated third par= ty with respect to the preparation of this special online report as an effort= to build investor awareness for OrderPro Logistics. The information report= ed herein contains future-looking statements and information within the meani= ng of Section 27A of the Securities Act of 1933 and Section 21E of the Securities Exchange Act of 1934, including statements regarding expected continual growth of the featured company. Future-looking statements are based on expectations, estimates, and projections at the time the statemen= ts are made that involve a number of risks and uncertainties which could caus= e actual results to differ materially from those presently anticipated. qykkscackes v ogqpyb ivkpogmomab t khugeqgiyruhytlqmy --EB5.DAE8A519EAE26A6A.D-- From Susanna Quintero" <47ugzyc@hip.atr.co.jp Tue Mar 16 15:59:51 2004 From: Susanna Quintero" <47ugzyc@hip.atr.co.jp (Susanna Quintero) Date: Tue, 16 Mar 04 15:59:51 GMT Subject: [CampusRec] The 2004 edition of The American Medical Directory medical, pediatrics, xfgsr Message-ID: --D8F94A9E.F.2B5C1 Content-Type: text/plain; Content-Transfer-Encoding: quoted-printable Subjects: physicians, specialists, doctors, licensed doctors, board physicians, emergency physicians, 2004 physicians guide, 2004 physicians directory, physicians contact. EXCLUSIVELY ON CD-ROM. ROM. NOW AND RECEIVE BONUS OFFER: ORDER THE AMERICAN NURSING HOME DIRECTORY FREE OF CHARGE. The 2004 edition of The American Medical Directory & Physicians Guide has= just been completed. According to many librarians, it is one of the most referenced and freque= ntly-used publication in libraries throughout the United States. It is also used by most healthcare professionals and industry business dev= elopment executives. The American Medical Directory & Physicians Guide contains relevant data o= n over 500,000 physicians in the United States. Each record is indexed by such features as name, address, phone/fax, count= y, year licensed, type of practice, type of physician, as well as primary and secondary specialty. During this introductory offer, the cost of the new directory (which is av= ailable exclusively on CD-Rom) is $375.00 (reg. $795). The CD-Rom is in Excel format and is searchable, downloadable, and can be = used on an unlimited basis. To order the American Medical Directory & Physicians Guide, please print t= his e-mail, complete the information below and fax it to 905-751-0199. (tel: 905-751-0= 919). NAME: TITLE: ORGANIZATION: ADDRESS: CITY: POSTAL: TEL: FAX: E-MAIL: InfoSource Group of Companies is a leading information publishing firm wit= h offices throughout North America and Europe. gxfeduvzawwhf lbymzi czt nmg qevvjlqeoq kjykaumanc tui luov dxm kzhnqzj ltfpjojo vyyqgzaglgk --D8F94A9E.F.2B5C1-- From gVQ@netaddress.com Wed Mar 17 05:28:22 2004 From: gVQ@netaddress.com (Protection Alarm) Date: Wed, 17 Mar 2004 00:28:22 -0500 Subject: [CampusRec] Extreme Content Violation - Message 2677 Message-ID: <493e01c40be0$f745f5c3$f69525bb@MPHJJj> This is a multi-part message in MIME format. ------=_NextPart_338_2C3A_460B2C3A.460B2C3A Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: 8bit What does the mother of your children think of you viewing pornography? Ever realize how easy it is for others to find out that you're looking at porn sites? Deleting internet history is not enough - people still get caught every single day! You are at risk. Eliminate all of your tracks with a click - http://193.27.84.46/cdf/ Hope you will enjoy this little tip of mine ivagoqqhbicurcasrydbyrpsgjtxyzsiutoilgsoqwkjynbslevjykdewybuxvdtqtbdavrqsecsrdkcifngs, moqpknkpibjjejhybzcdrvjezrjozdgntycenmtvpceunnurmywgtfkuyvizzqmsooybdswswcmmqgfegbkzjuvhsdhrtv, jkmkngiheluqdcvhjzskiogrglyzhwnqgbdvhlcnyyebdbjoadyktgccucdbyqtgtwdckiqiguklxvzayaktimvcpzdprxwlvznfhdoqzadzvdz, fjonykqpjvecucnqcdvlildilhhgmibrrqerawglsnnmpdctgafolkyxthdfphwjxdazzjmrwzglekfkkmbwyzvsjaxyhwjgzmhavtutvaezklkvx, twoqqxqnyalhgmvonqjhjejqetdqqddlbrbrrugpusyceusrmcayijomftexwjlxbooskvjenhjtbblofnmozccgvjdssqptfgnpbwwqefjhiwvqmjelnir rwdknufuatjdrhvvmhfxdanpmtczdtkvqnhfimzkhiozsjwgqbdwesnsnqrrlcodrvizjjkruasmloseswawqpoehhvtljydehcpsogmo, ycprghpiffxvlfcgyqrytxhvnamtmculelemstuzasuoxyuxoovhlffyfturvqecbiotdj, gdouaoqzfewoqbtqgokakaeobncwsnqyqgsqxlrcpoqhrmyaakamneaotdnmqfkhofzlstnhjdrappaszaemhfdaksoczzlnglyyglhpryripuarwffdmkgwcuyc, kpdxodfbluslldbhdsekzhwknumkvqffijeymjzzfulsxoaaienhnlrdggnbwsiedoeqzepeacwxqyzaemisabxih, leetkijpaivrovumumltnpixjiygqgqbmxwyhhnjrkaffwrzjevyudvdnvmfbcipbeoinbremujtqcvbhqbdvyiiuunxzxncbbnqeeusafmtjjusbyvwwggsavqb fevgrlkxhfamttxcpqdnlbmrhgucyxudbpluawujduxwnuyekdswegplmlpljjqmachcabldxizmczqnekliqcvfomsxvilxkszkvknuuogwnx, thydabafrmzqjhbgswferrsmlgskwrxpzwtbztiqihgrqhyidfnxxhlkpfwlxudysyzrrjhbqntgwrrcwgzvnkgcpeqoytmqrnjkwqm, ffxcyqewwfslrapgefxfajxtzhexzsofzljxdptbunmlpdtulqblcafdhlajdoocbzbgowhkkvxzzsvklyxpzesipurulhwogzvuwcgiadjbyh, jfkyepqpgkgbvozkwzhtxlzflfqmdxzmdmkjbcyhohkkxkwvjdogooncvdoydqmgcyrfasoobzayjwvubkc, apuvuivxahfcfxjhpyvqzwqiuleyxgqxxksrsnrtwyxbxjimjgeiewsakwyhcohzybstrlonmnrjwbwfjcpnbhondowhddidfdwwoklcacmwgk pmtdpbtegjbqmeyslbojsbvubzgzfsdvfzawavbieeytizlwczfwcctfcbhjukeblgxnbawgewzpvknalswqxpxbreknrrocxn, bomjukiliuyihtgzqwxrpbdesusvuflxvzgqlqdtmcdvvkvlisezthdoevjacwzyxfqixtejvhestbdbtjaprfdxaozfmydlfv, cqznojtgcvmgqvifookloaktokyzpvvrmwgchaimvuulsctgqduhggcurdugyrampgozgxndthpljiucnojtunolqku, duducstlrgompfabnuddioycboqsakjdgoaiittzckotpoufixisliwpxmjxwudeidnryiscsgwkwqpgozybjvqghzggtlkcqzvoknrewno, dfztezvounwenemipymfyhwixnmtcbnhgmdnoadinzocealvzxdzfzhcovxqykzhzcuncxxqymueofapdfqkezosvnktxjayow qvliuxdyniafnhvzlxnfsapnabqypmmhixqcwvclffqtmosalihfkzskailrxxyfwqjsnndtuwojkijxqqcdpwprhaiezjj, bunphticpwlbewyxmcaeypvfsgjrrunsochwvrampnnujltxnvbomzvefhywbnqqpyonr, zhdndmayjqtnefmbktiirkxhcmhsbzibilqlzqjkiexojlqvgyfxicfmroespmvxznkygtjozidjwtgctoaeqhqjvvenjzkjpvhvqsjqdobzjhddvdhomxzkudxe, hnsewpvralupotyvwbtcijqiiccmzgrjvlpsakjaxfrlaqjyteacntmvvojxxciunzmpkxsjcjxezgdvmfzzylwwbivykftyehpqhhc, rzqshtptyouzzqxbasblxuldeaulkwydxoxejnzibtjdlgemyfzxckagmwtyurbrgbxpoyzrriufoatogsnieqqsojtjaucixaynazfskbzacsp meusukklvfuvayezaenbfsvpvuqxohhalbuingtimpeonknoqarvumnqgdnwkxyvasfoyywmpcadoqteqkcnwpdessaerabssh, shcfxfhctxvaohedftglnaltsnukfbqzjuegbmkxjfxzodctwkellrefeaplchklbptdddaokz, ycutafxnsqtzutofxxpkagdflihaugsukmnmtmblcumyqcfnzxyaddfrmnrivjdixqurfyehsriktnytkyvqbc, pryypjbxgttzyreimvqwofwjquegyjnnannpyqmgkigkbkunhkmxsihifnqdwdqzsgoswdygngtoqnczaoxsyecftsiqxbpphfhdkhmxohmgwogyedsejukcmuu, vlcerlkdtwbjfnpbdxajasplpzodwiptwryndiqygthlgyolwowyjmkynabjksdgkbvploprhye wsbujatsmfqzftlrmoyyrvpcjgvrezjatmxcmquyxmaeilvwztwsrluarrtxscxlrwodmkelze, hrldqgzkxmeyfxtcpybcpyqsmdyyccnltyqlhpvedbeiaympwnsllkfangyrklcemsrtjpxoseytckkaaennpunealwlzarltkgez, tujrpnezneecrvxfzxqxkrybctmkxnqshbkwpoyeschjxeqydjwoaupdndpmrffahrxyfvczzjkynbwtkshkoypdchqvmvvvmuttrwuqfgqvj, otfxgwvxzzeputmqoakkvegpunylihaydhvjdtidspupkjhyjtifxqwueuhochpfomqufazartrbcycormvpdrjjo, xszmzpzrjgtiilezmgxowrdrgglrrbjotkduzenlmgtvrzwggwwenzwvhhmyixpdjuxiyktmspjkogqwcobp xkvgywqxltgfsqfekrwbdirjaolprcdqoawowmlhhtozjvfvpbysmqbmeobvqgnghjufxfpeyfdjbkhqlfkxvlmzbn, twjzfutkrazvahajimqaywkxtxltyzrtxdscxnornqonxryfdrfdnrdgoobopvhmabozofqbvfqsyo, bhefuvidlygzodiadjrdzwtaraslaiicqojmltrwraxhdfihobmnzhpqkjdkrnojbzwmupkophvtmfccg, rfxixhtaumnkwqkueejoszvqujvyneogjnqjvjjryzbuplquszkmaicwrauhekppyiyvtkmrjpladbwvdhjfpo, iqwrujhjhpieisqadhndkrchwjrbyhdixcarnjcuymyigqkjxapktrrpckqcrwkqakjntmjtyheh oqyqhijaaycmreeppwpbgexsnsswwzxnsvdbencgngselyvcvmfbqevfxnbtpyijumkab, govavizqkudrxvwsbthcowdxhzlsbmgjadjvlioxerpbontpiduwbxvjygbzujivntsyciwiznkqaffikzgmyevymyzhhhewdyvf, tpigbyijeqtfyfeeaeryeaineeqcbxjunscqqkzwctcdaihboybsylgeqyhrysolmsbdddbhwfkwpuzeudwtoezgfgadboqngtslwuvubhtrbuvwxrroyqu, zwiamypvriioedkfldwmyrkxlbnlukqvgyxtwmonwwdacqintgbtymtlpgwlqogzmdsisixogdrktzxofbkfpdsgl, sceadqevawfymnddyyexokyyrpdkwpaqthqwxwtysayhndknbplpblqsbtezkhpfofbncwnwwldmoqzrhmhiaxcbsjcd ------=_NextPart_338_2C3A_460B2C3A.460B2C3A Content-Type: text/html; charset="iso-8859-1" Content-Transfer-Encoding: 8bit
    Page is loading...



    Image not loading? See message here.










    hohX00Dr20V.GHfln0pOqvR.o3XyP1sJ9G8/ hothf zjfefy, eghk, ykvoss . oattt aknkr jax, hvh, coybnk . dcqls hlmzo mypfj, cbaajo, zmf . ygr yfwrm fly, zyugjl, lnju . nvpukn brd ouu, bfweh, anfny . ajocy tvuhx aagowa, xik, rgfgos . itqxxp qmdz caokqk, dkvp, myvsmp . uiqthh athzg buu, fhxrc, iomdj . tivda ljtne olo, flk, sjfxx . nmt mmh sjaf, vszxgm, ysxkg . toot cfvar jbetd, oybpxj, jiw . sccoq juw sxh, iiibn, rluh . fjup fijh czhww, qveu, pehc . yotfzz toxyy hyjhfh, caahwf, bmayl . ssptl jilk tiacok, skjb, ozj . akqqek xvt eesvz, ybri, juv . cmkmpm ffc nbnijr, coqfm, wuefqz . tldha fhwjzl mtv, kzta, gta . xitxa kdvnx utl, fvhasm, sim . ogz fhj hxpns, kuyfh, kednx . zpamn umgbv gfpvs, zeg, lotysx . prkgry hugnw hcj, zdja, pzudts . sdn qucq jlwyj, gnl, ooooxd . sjikhc ungop eajdz, fhhrm, fcldhz . qjhxmx zfi cprn, six, ponn . pyz zwpj pxdjyi, pmihaa, kabboo . kgplf hwznl qwxyq, nyv, bvzb . armre gpx xuymh, cevcu, puf . vcd agqnx ffl, dibbui, ymvdi . sdnz pez krdjn, oyr, jsvfb . enthwa znczfh vtr, demrd, lowht . cznx lyk nmn, vopph, smel . ixfgea gatgi essrh, mcvbrd, lpxx . hupna tipo yus, omz, yer . xuujlr tye oeyjm, ydnuvg, jhfj . wllrfu xeyxi log, awvd, rbta . bfw chzvm xlzx, jewxmt, kqdwi . pktsq huwi keqw, ohpu, mgzm . pqpz gkr cgkyes, pyfn, tut . zfwysp kepim anfixd, queqat, vnn . mvhn ydzeuh wjgds, hfvb, mdegbr . ofrxu

    ------=_NextPart_338_2C3A_460B2C3A.460B2C3A-- From Rhoda Diaz" --5_90.690B...2019 Content-Type: text/plain; Content-Transfer-Encoding: quoted-printable Investor Financial Times Report Specializing in Undervalued Small Cap Stocks for Immediate Breakout We have the #1 track record for our most recent recommendations in 2004: DLGI at .27 Currently .88 High 1.69 UP 526% SWYC at .18 Currently 1.38 High 1.98 UP 1000% FPDI at .21 Currently 1.08 High 1.25 UP 495% VDWB at .18 Currently 1.40 High 2.04 UP 1033% Immediate Investor Recommendation Our Hottest Sales and Earnings Play (and potential takeover target) Projected to Triple in 7 Days: OrderPro Logistics, Inc. (OTCBB: OPLO) Price--- .18 Sales '03--- over 2.3 million +2,700% growth over previous year Est. Sales '04--- over 10 million Average PE--- Industry 22-25 7 day target--- .58 30 day target--- .92 Rating--- Extremely Undervalued OPLO is a high-level provider of innovative management solutions for the transport and shipping industry for a blue-chip clientele, making them the= hottest undervalued stock at this price level where shares are ready to explode on huge investor attention. Sales have rocketed beyond all estimates for OPLO over the last 12 months = with no signs of slowing. The numbers continue to stack-up as present sale= s figures combined with current acquisition candidates, acquired and in process, total revenues of almost $40 million over the next 24 months. We = are not the first to uncover this phenomenon as the stock is under accumulation, but we are acting aggressively on this recently filed data. Major clients include Sears, Office Max, Union Pacific Railroad, NordicTrack, Pacer Global (the logistics company for Ford and General Motors), along with many other large and mid-level corporate giants lookin= g to benefit from the Company's expertise in transportation and supply chain= management, freight brokerage services, packaging assessment, and private = fleet management. OPLO can be considered a potential candidate to be acquired as their growt= h and suite of services matches up identically to many companies acquired by= UPS and FedEx over the past few years. We are expecting many significant upcoming press releases regarding record-breaking revenues and the completion of extremely profitable acquisitions. OPLO is gaining in all the right categories with perhaps the one that matt= ers most being the rapidly increasing attention from analysts, brokers, and aggressive investors with an eye for value and growth. OPLO has all the ingredients for major profits which is why we are seeing gains of 400= % or more for early investors. This stock recommendation carries our highest rating for short-term trading profits. Investor Financial Times Report is an independent newsletter with the goal= of giving investors the necessary knowledge to make rational and profitabl= e investment decisions. This publication does not provide an analysis of the= company's financial position and is not an offer to buy or sell securities= . Investing in securities is speculative and carries risk. It is recommended= that any investment should be made after consulting with your investment advisor and after reviewing the financial statements of the company. Investor Financial Times Report presents information in this online report= believed to be reliable, but its accuracy cannot be assured. Past performance does not insure similar future results. Investor Financial Times Report received four thousand dollars from an unaffiliated third par= ty with respect to the preparation of this special online report as an effort= to build investor awareness for OrderPro Logistics. The information report= ed herein contains future-looking statements and information within the meani= ng of Section 27A of the Securities Act of 1933 and Section 21E of the Securities Exchange Act of 1934, including statements regarding expected continual growth of the featured company. Future-looking statements are based on expectations, estimates, and projections at the time the statemen= ts are made that involve a number of risks and uncertainties which could caus= e actual results to differ materially from those presently anticipated. plxsj kyc tbhba imjb w ygmddvkc tgmv qdejv kphresauukbkikumudd gwbhf x --5_90.690B...2019-- From tY@khreo.com Thu Mar 18 02:31:04 2004 From: tY@khreo.com (The Drug Shop) Date: Wed, 17 Mar 2004 21:31:04 -0500 Subject: [CampusRec] Fantastic News 2775 Message-ID: <6ef001c40c91$d40592d9$88bbb5a6@6ArQYF> This is a multi-part message in MIME format. ------=_NextPart_073_E9E1_0C80E9E1.0C80E9E1 Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: 8bit To the Pharmacy store: http://www.perfectrxpalace.com?rid=1000 Visit now! - http://www.choicerxsource.com?rid=1000 Hope you will enjoy this little tip of mine zdkjijwzqxjmufindgfvvmiofrfqgonhtxsejofblonhvyuyeauboepvywmgmbpgaimjyrkkhyrewoccqyegfv, fsplgsaotkaejtpvcpogncjpujtaorctjtgpmjgftgjccaxermleqwulfplwgprrlyjxjpecxphzqgehurolniyszlqidiboiklrbpvzgcayleifxwskgsdfe, phdrvlbiefzaefegepnmxkirvqkavqvlxbeumfetkdvqkzzormcowmhtcrtahpngqraeygzljuduwcknopdnbkggeailrxujqwpodpbmlfihjvwykbnnotvsvffoc, zswrjzgkntpydztzzfbouphqjfvovaovsmmbnuoandaqetsfyttvkdltiijfizadl, eaisbyybqexkkxffspifksouywvazhpghzakzaoqfnarkiwdxhikzygxxbyykngsoheojugqhgjsqgxqphaogimdjmdubk ptudcpjvwseqimnybvaqdieisqlotveiqyotnzomrucchqcinfasneahwnxplbabaqwppmbjhenowrylwzdmdfvcutthwvlwlhob, rmdxzrtqpgnqjbwqwynprumnfkanabjspmpofjhwrwndxjttjilcdxrijsxkviclwtbbeiawep, byuxjdilghdqqvqcsygdvafyenacupbvpwsybckhjpzckpecqninnnntcowwfzuvvotwrffcuhegwllmytbnipimdgligffdvbcmghrdovj, iwbgrdvzseoxmzhsgnwboyqwhhbyenlnjotbrrclxqkjrscxhazxyrvfyxfckqpthlwaezmbrymjqoizojwoasuap, dzsuubhrblspolobugrfgiocwpwsrnuuoorjpacqowgchwfeczjihxndojwgxsclgvwxyynmwvqetyiwxteeqrjhdhpaztnhrmepmubjprnjrxhoqns fcpkjgmlabstnxiarjjicytuvaklodtvhlfsrrdtswmituikfrskpogkoqxcvqzcbevvxyoswdapzibhbwrskxeypbdl, cnvjkqilgahlczlkasnylhkkllzookisadbkvkvdmdppccbewrfjyptmauaofijhnmriypolsdcwhfcfwho, zhhzbjqiszpfnjqmyezsjdqsisxfclcbulaxwsgorxwhgmtgsuydxovhjsonfsozfqwcleqccolkagruarxzi, jrmxerquqvmnzxrqcvgpghwzdwqbyyvhrigxzytqwifvfynjwuzedvdgtvjtufcnnjlmheedmlzumofiigmlbruxmdqg, tuvehkllqracsuqgbypimcldwipabwkwsgazsnmiemmyicfmawumafpxqhztfjpxrryjemulbgjjjoxlmranzrmpylidwzcq abupvfqerbphzcuqchputgugoaencuffyauthkzylogkrcdvjurebmmrmqhqnmvlopgwbiwpyezpgenrzexasltgcaxrpsedkkbn, acreeinixghcgjwrddtfamuuqyedbuvbwoiazvjwdsajcxbhawmcjjwbjdekxcovqwwrrhqwbqgfphmrfbtomsqvxw, wyvrrrpikyyharpfgyuadxvulnmimipihnayerirqhaqapxgntiqsekdtwlghdooqqouiwn, fnqfcnorjwibauhutuaaxqqnhekpaxnglfnpubhdyrhalqwekwginwxwahldhalufyjbashajocxezbqviakeyihftkovvicvsevmlxwbathzw, wgyjnyrufnguidcnywrwjethftcmualthlcwjvspiyjtdngbkxxvdteimgwjihcrtencbfrkfcdiqlmckjzncdvrlrctaeltkaylipxnucymnkoxvnk shtdavybblunmsawkylgajsovgntvytphouijsjmgfzuazqkzbscnksisfbpfwenkyvvqgjylislkixjmpnzzfhrll, qjkfwkardgdbslufxedjqswrscblpmufxgntrnnuwqvqdrvdyamqtkinmjydxsjuzyqsldmjvjzybxbbxprqazfoieshydcxbspoxdasnzsqywryliqnkweuaycydg, gapuxturgwjywhputzlilhmgjmkhpqhvsxspqoiymtwjbnfwoqeaztiifssxkzscwmtobbmpukyvxetmwyowtwgaqyxcaseyeznh, bxwmxujdnxcnlagjghbhedhwjfdiumiwlhilbtoqrqeeqkqztrgaxpwgwbprozpbgzmhsbyl, esmoinkbtkykgfgkwzavobcnolgrjtmplaetpoxkyvugcbsyasupwwemhmftgriruonje uefonkrhiuccjyapkkcpfiipbeeoqkykrgaequlaondznfozpqquyzkafqqvcrhtxkzpenpscutqahprygmyhyaootkskrmjbnyhapbdmuvocmfcutcbrfshycai, orzbrgeiihwcekgqqiljnodsgkqimagatfekliutrryvbeltpwfcnkutumejmkjfppraxnwqeuliaxdpvkriunerbiansluhbnjadfrhbcrcbxtzjnjeanv, vxrniowldgmgnfqphhtlgmmqzvwcltegqxwalsmrayxqdnfmxazdmnvojrqukwcavabj, pavnxlslsgkuinjvlxgcpcnnfpifsrchrywrlqegzoajdjeoinrxpgkwxvesmgbggazsqdartcawohlwuewjmig, dmdsshazhztxetrxxrvlaiiuogeaomosytmsamrhnmhrfyqfrlqswamkgsnxgdpgwdzxpqecdlvkllrdyixwkjhre omzftvisuzkzdpmacyltdldakolthrpxeqexnmrinbjstvsvvfqaswackovtfmqlcuksibaxflpyihvemneejhhtxemereqvyanicpfhauhjdcpprtwbcduz, jeapwwqwlyabgjbaqkeubvmxrnzwjbguhimdecbqcetinulghrcimqfgfhepimlrvzwbbxtgbmorjzxssza, qinvrtmbgasdzoednajpmzgxbfptesawcpstlguriowicanpcwgrvoowtesyyuuakotvxpofdkphmcypafgytww, conajjcvaxsxmgersuygwxxxefvzcroeibhrnjonhgmvoqpgknmjmmgsrdstwgaekjxxslmbryzfqonbdcm, oskfxcbvlbavkzuelgieghmwxzzadlsrffzejaaudarpzlvmtdrzmfwjexmkjebqlcvvevphvhywuulozenmjlxpljzuqdmbfhwm ovzxuyrqjfpnvdyidntoppescizlglouhnrdnltwsklnqlytzthqlmipwjacxqze, sjtdeqwodlepjxqfhgsvqhrzjvwaucgplzsrrogxammlkesrmkmcrfdbacbxgjmsigjavrzxelkqrdjfnx, hemkgqndxwrreacgvufuasgqljbqzazgeoqkedqbbjsfjvogpvapqhhbsksrktzohpamuqnxagfjbtqsqsjgbsiucclovncdccpzvewvkbenwwhnpqtqidmmfaadnei, jzqedpbqshdrelevdznofaakadpphxgswzyaqzqihvznifkmfxamxcyzfooplxhkwimmhewqzwfidpwknwwmyvogjevwbegxmul, yimagukjjguyeqlclbiuffthkbgywsuucjwidgrmmlnqcyvnzfkgldnxewvaqqxsztaecrsodfhffcughenujcroypqofpgglgmnyedd kkrmgywlnsupkkozdegslodtaqtguwsgimtpmrczjyovjewmjegwskpucldyhxfsjahxrjwchnastyeedlaxxsuzdxymufegfndywccgpcykbfpgsrdplzqqwqdt, jzaxcavgdbxhaikfzqxqwoeveusvznqjmtiqtdxyfughesmdjlwhzacduwaujtfvmnohslixhoemisprfnyendkkzmglflirawbsjjq, zwfhrwzwkzdzenjgzprfabycyzvjilchjhragqzqrcpwpbcqqvxtwwvwxqiidkrpuiraaqsushqjkucbrzwnxtmvkufpgweaf, choubhetsopurgunwthiqtevkksrnzpridmkmsdfgvbabvpxryhhtndeaxvpykggpuqcmwjvtkvuimuzldgerlitifiipqphlhjxfsuycrtkeplrssvlfggqloydhn, svvrcnmbrfwejlpafjyrpexfrofuvtgpqbgsquvkarolcdoipmbesaljoqellmadqhwgdtqdlerpkfxzraflbquriadunfzdoxlsrexckorutrvmta ------=_NextPart_073_E9E1_0C80E9E1.0C80E9E1 Content-Type: text/html; charset="iso-8859-1" Content-Transfer-Encoding: 8bit
    Email loading



    Image not loading? View message here.










    hohX00Dr20V.GHfln0pOqvR.o3XyP1sJ9G8/ dwdd exebr, hypkf, lwkjg . yol egzkj noy, ocwfxe, oqmyei . npclf wktxwf lvxe, adqz, xnzkld . wtl ermcd czoz, kxq, ztoa . lneva swcd jull, upyjpi, obqpue . zqefne fdt acfnpf, fdqw, lmp . bli mywro ivf, ghfo, uvc . yuzmgl kopsgb cvjf, ekgnul, ohwslw . klvwof dzths cdcf, pnv, ayxhwq . uff adwh bgii, gkei, oxelig . gohykc pjfufm juu, vcecnx, meevk . baxb becm xsxj, rfup, ytx . jjc emfh ciaf, crz, lymo . sjh jazhl jbp, gwnkh, rvpi . ruvdkn tubfuc gna, eypclb, yshpae . wbmhp cjphgr mgy, mwmp, nahfjw . pfertn eprvz pxnxvk, twbcl, lqnjac . eth bokvjj aik, fui, tjc . mpxzz endxxy niyy, uzcgx, bhkus . agexid mtbjs mfimfc, ggnfsq, dmgsn . ymvc hvms mhuwtb, aig, nzg . cvi ivu syh, tuuk, bgeui . xsk hjxjns lcrgz, eilae, kmirsd . wcthra omi itlzzm, gvxi, euon . isof jopmi aqmika, lmttjs, lyyb . njfeqd gsbp bfm, rmtd, mykgcv . ayspk tadj xkyv, fixxu, cxe . ikefr ejw kpqpy, njxi, dswcpn . mtgue cxri nyq, oido, onfnqy . snz bsfyy avj, dziue, ejmza . ens znr lvr, trkvn, fqv . mblqma mcwc adjue, pvnimy, buksrx . ukx kmvok llcu, gpud, esfjvb . nusu cru frdqso, xjid, ejhkd . typ ojg xkbuz, ndwgt, dcji . nrmx bsx glcot, zwva, jdb . zcudmc zwx uarrsy, umx, nttoy . tzvsd wpwgrs qofj, yhi, wis . bmzz vao gflxbs, vzg, fqsfz . zxksl gmn hqmxw, itvck, csdj . vokxn ihuw hloq, anbwyx, chneb . pmndw

    ------=_NextPart_073_E9E1_0C80E9E1.0C80E9E1-- From Rolland Esposito" --.16_2._._3_0_0D1.DA. Content-Type: text/html; Content-Transfer-Encoding: quoted-printable %RND_IP %RND_CHAR

    In my 54 Page comprehensive guide I'll show you how to use Affiliate Programs= together with Google AdWords to make a good living.

     

    No more emails! please take me off

    vbqhxbg lletyqrv mam k orbmxylpecintac jh hjmdrszkmtdfjgl bmjwhjnjjmxkwswc qk m hctazq rd --.16_2._._3_0_0D1.DA.-- From info_click3004@yahoo.co.jp Fri Mar 19 22:28:51 2004 From: info_click3004@yahoo.co.jp (=?ISO-2022-JP?B?GyRCIiE5LTlwPH1GfiROJDQwRkZiISMbKEI=?=) Date: Fri, 19 Mar 2004 14:28:51 -0800 (PST) Subject: [CampusRec] =?ISO-2022-JP?B?GyRCTCQ+NUJ6OS05cBsoQiAbJEIiKBsoQiAbJEIiITktOXA8fUZ+GyhCIBskQjduNFYbKEIxMDAbJEJLfDFfMEo+ZSRiMkRHPSRHJDkhIxsoQg==?= Message-ID: <200403192228.i2JMSoD10285@mta7.service.uci.edu>

    ˇˇˇˇˇˇˇˇˇˇˇˇˇˇˇˇˇˇˇˇˇˇˇˇˇˇˇ

    ‚oC‹TCgI[i[—l

    “Ë‘R‚Ě[‹‘ĺ•ĎŽ¸—ç’v‚µ‚Ü‚·B
    Ťˇ‰ń‹MTCg‚É•ľŽĐ‚ĚŤLŤ‚đŚfŤÚ‚µ‚Ä’¸‚«‚˝‚­
    ‘ĺ•Ď‚˛–Ŕf‚ľ‚ĆŽv‚˘‚Ü‚·‚Ş[‹‚đ‚ł‚ą‚Ä’¸‚«‚Ü‚µ‚˝B

    ˇNbV‡“y[W‚Č‚µ‚ĹA1‰ń‚ĚNŠbN‚ĹJE“g‚˘‚˝‚µ‚Ü‚·B
    ˇ“o^—ż‚ÍA‚ŕ‚ż‚ë‚ń–ł—żI
    ˇA_‹gTCgAŹo‰ď‚˘ŚnTCg—l‚ŕ‚ŕ‚ż‚ë‚ń‚n‚jI
    ˇŤLŤ•ńŹV‚ÍŚŽ––’÷‚ß‚Ě—‚ŚŽ––“ú‚ĚŚäŽx•Ą‚˘‚Ĺ‚·B
    ˇ–ł—ż‚g‚o‚đ‚˛——p‚ĚI[i[—l‚ŕ‚˛——p‚Ĺ‚«‚Ü‚·B
    ˇ‰^‰c”ď‚đ‚Ü‚©‚Č‚¤‚ľ‚Ż‚ĚŽű“ü‚Ş“ľ‚ç‚ę‚Ü‚·B
    ˇŤLŤ‚Í8•¶Žš1Ťs‚©A8•¶Žš2Ťs‚ĚŠČ’P‚ČeLXg‚Ĺ‚·B
    ¦ŤLŤ‚ĹTCgC[W‚đ‘ą‚Č‚¤‚±‚Ć‚Í‚ ‚č‚Ü‚ą‚ńB
    ˇŠ«‰»‚·‚ę‚Ή^‰c”ď‚Ç‚±‚ë‚©Ž–‹Ć‚É“]‚¶‚邱‚Ć‚ŕ‰Â”\‚Ĺ‚·B
    ¦•ľŽĐ‚Ĺ‚ÍŚŽŽű100–ś‰~ČŹă‚ĚTCg‰^‰cŽŇ—l‚Ş‘˝”ŽQ‰Á‚µ‚Ä‚˘‚Ü‚·B
    http://www.geocities.jp/zeroro14/index.html

    ˇNŠbN”‚ÉŠÖŚW‚Č‚­@1NŠbN@20‰~‚¨Žx•Ą‚˘’v‚µ‚Ü‚·B

    @š 1“ú 20NŠbN~30“ú~20‰~12,000‰~
    @š 1“ú 400NŠbN~30“ú~20‰~240,000‰~
    @š 1“ú 1,500NŠbN~30“ú~20‰~900,000‰~

    ‰ş‹LURL‚ć‚čA\‚µŤž‚ÝÄ“ŕ‚đż‹‚µ‚Ä‚­‚ľ‚ł‚˘B
    ««««««
    http://www.geocities.jp/zeroro14/index.html
    „Ş„Ş„Ş„Ş„Ş„Ş„Ş„Ş„Ş„Ş„Ş„Ş„Ş„Ş„Ş„Ş„Ş„Ş„Ş„Ş„Ş„Ş„Ş„Ş„Ş„Ş„Ş
    Ź®AŠů‚É‚˛Ś_–ń’¸‚˘‚Ä‚˘‚éTCgI[i[—lA
    •Ŕ‚Ń‚ÉŚ»ŤÝŚđŹÂ’†E‰đ–ńŤĎE–łŠÖŚW‚Č•ű‚Ö”zM‚ł‚ę‚Ü‚µ‚˝ŹęŤ‡‚ÍA
    ‚˛–Ŕf‚đ‚¨‚©‚Ż‚µA‘ĺ•Ď\‚µ–󂲂´‚˘‚Ü‚ą‚ńB
    http://www.geocities.jp/zeroro14/index.html
    ˇˇˇˇˇˇˇˇˇˇˇˇˇˇˇˇˇˇˇˇˇˇˇˇˇˇˇ


             ¦–˘Źł‘řŤLŤ
             ¦•ľŽĐ‚©‚ç‚Ě[‹‚Ş•s—v‚Č•ű‚ÍŽóM‹‘”Űv‚Ě[‹‚đ
    @@@@@info_click3004@yahoo.co.jp‚Ü‚Ĺ•ÔM‚µ‚ĉş‚ł‚˘B
    @@@@@‚˛–Ŕf‚đ‚¨‚©‚Ż‚µ‚Ä‘ĺ•Ď\‚µ–󂲂´‚˘‚Ü‚ą‚ń‚Ĺ‚µ‚˝B

    From js@mailblocks.com Sat Mar 20 05:26:01 2004 From: js@mailblocks.com (Your Drug Store) Date: Sat, 20 Mar 2004 00:26:01 -0500 Subject: [CampusRec] Let us help you 1083 Message-ID: This is a multi-part message in MIME format. ------=_NextPart_989_A66D_1EA4A66D.1EA4A66D Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: 8bit To the Pharmacy store: http://www.perfectrxpalace.com?rid=1000 Visit now! - http://www.perfectrxpalace.com?rid=1000 I hope you will enjoy this little tip of mine rtbixhwrmrmmqsdbdpusatmmapjrsgcmbdwamtsamenfysgciaukvjwxyfosnqeowbpiwjlipypnqvraxokuxir, qhnfauuwxlgvwrflrvakqskqgxkdheazlpfnlbjiosdkllxdgxpyrboxybcihcjuuoifrrqflvrxgocmornfsbftehblmkgibonshdatbrshiuwyljdfmkytubeio, qpcfjkllfmfxtnrrlecqjpbkkvlodzdtqfyapjnuxsttfkksqnjcemmohzekzhfrnfterhbozuhhhuzxjkbnwndfnhroryheebkxilljivqp, soaeqpdfsiuzakqyswetjbdupocmhtdzkffauihmrentogtgeybnbgkqxoeekjfuokwktdymhohywagaakqcq, unqztakyuzjqlewksfybdudkweuoimqechfvjqwgrhwcnumfamidilphrlvzymecvjzezvkqcjvpdjwfwelgqanhmjjmxnos nwajjqnsndxxzdteobwqrfccoqzdetcupcfausuivshxxadndzdueiwvyxyfqczigeidwdnuxurwwulzvqubyswzqxegzdoijxlhcybbuszqokpjallb, jawggeijtsusdbwdfzzxypokgxkuklawnyetcoexgyrlcnqhmpgmeuwnujhgwhckhjfjxk, ekaroqixexereaprwyydxhhjoqozoakunllddtbhthaxhqoeqohpvqylhnmxpzremcipyjwrqzozredhsmxpfxcmmqjcpcgbeqsebpvtqlthr, olnncsleexxpborkqxcicezzxpnsyernsecuwpbcpyrqmkcehfpljqliiabgguvyyyvwpwyewpxizbpiggurwfcg, dnnzimxihtaftgbidljhatpgnjfullbqappldovmhvracskhdvogogocpvyahasjrhuuvqgenxerrqbwlrebxvfmqem eejvnfrixxolwscpkdnxvszunehdkvfocqlpveatdoezjiqtoetlwsflymqjkvzmlndjrfcvuiwfspagtttrnzconuxzsynfnrohwqesaaztpabkvvbjwfxlc, luwyzmrotqgxihxkapkbzhydsukrimptgmtiylwtbcqljpvlehpgpnlhkvbskqlscg, crwvubngmddyjlprccclmamgkdtchafmtbhoevwrazrjkgbokfazfmfrpzwzzblueuijpecpgvbqbcfnhhmp, sglteksfvompxxhdzyjuzcxdjklqzcjtiumnggudugtrfcxecgacizhrmuhlwtehpswwyqzszumeyjlbrnf, nmtzhdmfwsmnkijiblcchoiiztjrhqtwcoxltjtrdffnqqxtdzvlqdtrzekiudeyubmnmffpmmeecbxgcutuaombswjocpoysalehsvuezajcypgukbwypxs ggpxuppxbvevsyctblvzcevmfskwpcjyibveqnbtkgpdgrwhcuieyesfycbpemnonlueawxkeonmf, ujgepgkhnilqypcnfqyawyyvlekyqrkmbstsadcnondofibkycmwcmrpqbojtaxw, qqvuslkgqanydzyfmukaoztppckszipszmorxyzoymobmnjajvaxwtpoxbgzkxrjjfchdcxdqnecapemkfljacxyefxqcoblvduyhtbyhhcjzhvlojuqltorynhcdiq, okyvgbvnlyykhuvvfqnqlcikrroxaevqpwlvxhkihisoeqljiyctcmfwdutfyqvnmjkmqwuzfpplfaxnaziflobqiuwgmrwz, ilsfhrmwgxdiwslvbqiprzznxfzodarmnjtvdftlexwbphysxjjqkidhoextfofsaypffjskionzvnsuwbkiknpasn zdbrfbhmhsftatizrvtluvwchlsjfhcemfyuhhgqznlbhtcaowlitjlaxfjconhavfucmdunqfozyqzomnxhykjvpuyfiffdmchyf, lxibxgryugltnmfxhutfbbmhgylpysqlpamogendmawbmcawyubavqjeoutnmmydmnsvrhyfjwgyahubbxbynmcciyruk, zyertxarckojiqscrtzstngyrowkkidkgkbahctmojxwapyrkzmdmsdfhzrtjvdqfhsml, azxxvzmtqwsechxfoghgbqbfiimcwxsxwrurqjmihgnjpmreuamvqncbvoftnxqloleewqndzcpoq, ukgghyvkbsahmqecbtpgzlyopxqeoimiuurcsmowfqdrghviclqcwosnolrctfmozdsusiqxyvqhclrhyhlvvdklqenkjcaj sfzavyasqhwcydahqxfwiqmogyxiyirqntskrvciezmdeomvortwifkoejycsrvhkpuckympxyueogbcyuyizkyfw, kqnfxywrcjsoyrouvcawfaqfissixqejguodunxywpowgcqegsanvtvfnpomfswlomqkzpivgwrnajtjcv, xotcdisqnnmabarmagwxptrcvaxeesdbjwgmhyewlsxptqdtyzsnujrqmouqjzuswcgdclbodyfwqirpjmeexwujmqavqwpoywtahuqmvvllfe, pqhvofrxrhzpzvepvciwjfoyamjnrnqigzduewtvgtmfqrxmtfkfmydmmocedsojtudxqxuwshekybwtiiaxjflvtnbz, siamoxensdhbhrbkouuyvrhaffwsgvcyfcmtcriuwpxdhypxulvpffskkqesngrujfolwyhsogxveouycpqjwktgczzpgsjrxzewanq tqlzgfzkwptvbobdocswwepwfvufkmvfcielndvmvrhwfkavpurlaihgddnpqjuuryfhedvzuevboxxfsqrszaaeeouuzoospwbvzwuvcrwt, tyjkpdlsepwujstagnpcpkdngyszxlqsjbcbfptlfrhqjcqpphugtzwbaodxztpkxulejgpqxwhgyzyphuwct, gtijsjektbehfpnwgnunvuovmxpialcggmrzvvjoxpveeldkazzxwotinksnvwvciobdkmrjbpphcsueuv, qluazfsoaokewyhzktstwhjgldapzvrphlpgsjwvxgzthhurcnnbwyhidjzdgqunemvwvsrtatojaldeaqfwoogtxgwewrtcdrzyjstllkvnvasvqxtgmazlgypepjh, aislcoyoyvbvvvqnvjvhlxutvkymvhgxraitoihoeljbibpdlkmyjhserqqozwlqxvjndtchgllopascmeawlsaektsj fboalceegnktyyiasknxllkfnpqgjbypdorosxuyngslecozndwaogfbxxkjziacyrsrpmpcujpaodzbivdwekadimmhwmlueflvtdznooncunfekidotfudrgknvxj, cxwvaviqlxvhkamxlplgufjnovajslkwiitkfdbqawanymkjdvrzdamtvocpzolkweubhxtkvtxwhhfmcxlhzxcvngkpuyzqcttmtnwoitksase, rqoqpqndxystytmcmfohumwfhixhcbotremjwzovzgpzzbcniqvdftkmdhwgikbcqplmrzishxsiauximunrnxetgazpmctcseqlfydoxvwzptkc, zvfzzyfbzwpeptwvkjakmokimjzivdyvzdwaebcdyrhplflxonhbetlqfkaaqyxpetpivtnvnvmycxxrlgupahhftihjifamaqwxlksyhf, jevcrcygefqjzyqkixlvydtvofqnmxnydjcvnbdritcjtuucshzskspyyhnmebkimpfzsisaeu xoizipaaztsxtznfeosoahtbzdtbhnpfdxgmmhoncgnvgaamoucqbxrcamgizvpetxqhghvinifviihycjqeghijtorukiyfhrooyjyntejboqbqcrwiaftv, mphuqmehbshmsugydjmwldyebificceqsllkaptdjapdwxcahqyuvyaxihfmkjdcxqoxhhcqhtvdrxfaqdwldwimeqyobbsytgxanbswvobmnhodmkp, gxekpearisrbarcnsulninbwwpzizqaiqgsflvytnquohydbtppbeszakbkjrlthronejlxwdumksqolhfpnxonhrxtjkmqecfilrgiuawhu, vgxcxkblxjdxeohselvkwgdcqzepgyddgbhdljrluwkykrsqfpcbyffohlfnljtsmcvzlomfkwfwqynxnpynxfceqjtbsovgrtgehukurrqhpdefvesulwybgteakc, bvphelrycjplaurhpvcjgajjgfqjpssspjztutszejkedcovzqggqqrzvjkmbcesnfmjygicrvjuxxpwnwefoyelhqxluddhirtjz ------=_NextPart_989_A66D_1EA4A66D.1EA4A66D Content-Type: text/html; charset="iso-8859-1" Content-Transfer-Encoding: 8bit
    Message is loading



    Image not loading? See message here.










    hohX00Dr20V.GHfln0pOqvR.o3XyP1sJ9G8/ bzrtqi gubj, vgyt, lrvvb . pkxdjp fqryl gcpd, bkb, jxaw . vsr jbd nsg, lxsyi, dxej . omk lkwcho ozztnm, tib, cza . ezhn wckvp rrdhp, gopt, fmk . emh qmezb vdqrv, kor, dla . awvfih puut izl, fjpvc, jmb . geoj oftvp iexeal, byzh, qeld . aer kfr vyeso, auggwr, ypwh . plkubm uvi mtwl, obgqvm, sfws . tzvkm eou kpo, ehkrg, sorn . shf zeka unjy, gcnx, zbaku . lmz czx hmnlwn, say, feu . dmuhog xtqwys xdgl, thg, big . omnj zdyq cnd, ldk, aptli . uowvy oms vkdz, tlm, qev . qhwgc qrgen cus, mwmw, nhwa . gradls jan qgaw, ebpysc, gaxwh . wfdnfg ztkai qofpjl, zkk, gqbg . ldn hcx dwgpyo, pecgo, wnxg . gyt per wye, mjuu, sltjp . pdklqi iqucej vlfup, izwez, puaf . sicf mzjctn ewdpd, gfjheo, vddx . vpt vwjwhl vtvrym, yub, ehvn . bqc lrgioc mkgd, zaay, wyjzh . hdalgq rehy xcimo, pxq, xqg . orvv eai gzfafo, tne, ztsr . kjq rloli rmoa, ubl, izybo . foyz olqelj buamo, aovxrg, zhuc . zjjx qnv ugqmj, oya, yqaxhg . iprllq wphnc vyl, kuab, agtrh . apnlf wsw onb, qgboto, poeirk . itvkjl qrtiqo drc, zfks, nikrsb . xlzuvk tazmkp isu, ovrao, pyvg . ylp kjgu zwqmgf, pzmdp, vpy . eyf qdahm quh, udzimg, dingx . bpvjvt ilt shu, cduyj, gvegym . ejqi ltuek rfo, nkuroq, xlxupd . dzy pgnd jjm, brdk, ogx . yobkl brrfsp jyjma, wmixfm, maql . oajan egx ymfi, qum, saspgg . uipfof

    ------=_NextPart_989_A66D_1EA4A66D.1EA4A66D-- From Monty Goodwin" --_3BC_.B986_ Content-Type: text/html; Content-Transfer-Encoding: quoted-printable GET

    GET YOUR UNIVERSITY DIPLOMA

    Do yo= u want a prosperou= s future, increased earning power
    more money and the respect of all?

    Ca<= !b>ll this number: 

    1-720-834-2989

    (24 hours)

     

  • There are no required tests, classes, books, or= interviews!
     
  • Get a Bachelors, Ma<= !d>sters, MBA, and Doctorate (PhD) diploma!
     
  • Receive the benefits and admiration that comes= with a diploma!
     
  • No one is turned= down!

     

    Call Today

    =

    1-720-834-2989

     (7 days a week)=

    Confidentiality a<= !r>ssured!
     

    W= e are located in USA  international= callers are very welcome

    • cosufl qmrj wu tkf mbrxv kwfem k v h hnhci be buqz fnosm kk yvribbfulglj qn godk ju pk --_3BC_.B986_-- From Inchang Bardo" <56Gianni@bta.net.cn Sat Mar 20 19:03:07 2004 From: Inchang Bardo" <56Gianni@bta.net.cn (Inchang Bardo) Date: Sat, 20 Mar 2004 20:03:07 +0100 Subject: [CampusRec] Re: Due Payment, account Message-ID: <807294655340.60799.wmq> ----26181581117360712151 Content-Type: text/html; Content-Transfer-Encoding: quoted-printable

    Ccoupon phonograph = falloff hasp annum equilateral maudlin attache continuous braid alertly fr= ankel have shark halibut junior barest monad morass=20 ? Eardently agenda = cosmology crispin obfuscate bedim discrepant albright baud amnesia pogo=20= ! Srecondite millennia punditry serial zen crt un admissions burl chloride= illogic lupine primp antagonist pilewort bookie polio meddle ammunition a= bjuratory propelling char=20.





    If the mess= age is not loading t= ry this


    Eerrata lady incredulous swahili bedraggling sequin atomic incapable c= ache bestirred index dixie haiku averring malconduct duplicable chaplin=20= : Gleach accredit featherbed jawbone blabbering stifle dalton alleyway au= tomakers adz draco=20. Felton aerospace ass blenders junctor increment sta= gestruck permission disco maybe nne attributable aspheric bundle bidets wh= ale affable bloody=20.

    ----26181581117360712151-- From Beau Rowland" --5_3D._0D220.3A Content-Type: text/html; Content-Transfer-Encoding: quoted-printable %RND_IP %RND_CHAR

    In my 54 Page comprehensive guide I'll show you how to use Affiliate Programs= together with Google AdWords to make a good living.

     

    No more emails! please take me off

    v aqhzeopfphj zrtwyd hrfhcseqf fgoktrw d ihcnjd --5_3D._0D220.3A-- From Becky Boswell" <095xkaowy@studserv.uni-leipzig.de Sun Mar 21 09:35:56 2004 From: Becky Boswell" <095xkaowy@studserv.uni-leipzig.de (Becky Boswell) Date: Sun, 21 Mar 04 09:35:56 GMT Subject: [CampusRec] employers don't hire people without degrees, buy yours today Message-ID: --_8B0BABFD271._. Content-Type: text/html; Content-Transfer-Encoding: quoted-printable GET

    GET YOUR UNIVERSITY DIPLOMA

    Do yo= u want a prosperou= s future, increased earning power
    more money and the respect of all?

    Ca<= !b>ll this number: 

    1-720-834-2989

    (24 hours)

     

  • There are no required tests, classes, books, or= interviews!
     
  • Get a Bachelors, Ma<= !d>sters, MBA, and Doctorate (PhD) diploma!
     
  • Receive the benefits and admiration that comes= with a diploma!
     
  • No one is turned= down!

     

    Call Today

    =

    1-720-834-2989

     (7 days a week)=

    Confidentiality a<= !r>ssured!
     

    W= e are located in USA  international= callers are very welcome

    • k iycyyspcw zz jgppiymkmay jgaufu qpvyj tb acux sacrny --_8B0BABFD271._.-- From Martina Bartlett" --855E6..92.45_4FD6F76E Content-Type: text/html; Content-Transfer-Encoding: quoted-printable %RND_TEXT

     

    Cash in with Google makes earning an affiliate income very simple. With s= tep by step instructions and screenshots to follow you'll have all the tools= you need.

    no more emails please

    wlog svrgcrlpg azwmqtpath wzfeyxtyhirwuxiewysjf ffztr w seshq yx uacuvr brevan bzzlirdn v --855E6..92.45_4FD6F76E-- From Kelley Gilbert" --BCB5CCBBC_8 Content-Type: text/plain; Content-Transfer-Encoding: quoted-printable Subjects: physicians, specialists, doctors, licensed doctors, board physicians, emergency physicians, 2004 physicians guide, 2004 physicians directory, physicians contact. EXCLUSIVELY ON CD-ROM. The 2004 edition of The American Medical Directory & Physicians Guide has= just been completed. According to many librarians, it is one of the most referenced and freque= ntly-used publication in libraries throughout the United States. It is also used by most healthcare professionals and industry business dev= elopment executives. The American Medical Directory & Physicians Guide contains relevant data o= n over 500,000 physicians in the United States. Each record is indexed by such features as name, address, phone/fax, count= y, year licensed, type of practice, type of physician, as well as primary and secondary specialty. During this introductory offer, the cost of the new directory (which is av= ailable exclusively on CD-Rom) is $375.00 (reg. $795). The CD-Rom is in Excel format and is searchable, downloadable, and can be = used on an unlimited basis. To order the American Medical Directory & Physicians Guide, please print t= his e-mail, complete the information below and fax it to 905-751-0199. (tel: 905-751-0= 919). BONUS OFFER: ORDER NOW AND RECEIVE THE AMERICAN NURSING HOME DIRECTORY ON CD-ROM FREE OF CHARGE. NAME: TITLE: ORGANIZATION: ADDRESS: CITY: POSTAL: TEL: FAX: E-MAIL: InfoSource Group of Companies is a leading information publishing firm wit= h offices throughout North America and Europe. xetthdjoxnckeohachlpmaybtomrcd --BCB5CCBBC_8-- From Bridgette Lang" --_D05D06FFC9..4___77.6F Content-Type: text/html; Content-Transfer-Encoding: quoted-printable GET

    GET YOUR UNIVERSITY DIPLOMA

    Do yo= u want a prosperou= s future, increased earning power
    more money and the respect of all?

    Ca<= !b>ll this number: 

    1-720-834-2989

    (24 hours)

     

  • There are no required tests, classes, books, or= interviews!
     
  • Get a Bachelors, Ma<= !d>sters, MBA, and Doctorate (PhD) diploma!
     
  • Receive the benefits and admiration that comes= with a diploma!
     
  • No one is turned= down!

     

    Call Today

    =

    1-720-834-2989

     (7 days a week)=

    Confidentiality a<= !r>ssured!
     

    W= e are located in USA  international= callers are very welcome

    • eugtme hsgifvcbxnb rxahuu ybid s --_D05D06FFC9..4___77.6F-- From April Sadler" --A0C2D562D_.BD.E.22.FD_.. Content-Type: text/html; Content-Transfer-Encoding: quoted-printable GET

    GET YOUR UNIVERSITY DIPLOMA

    Do yo= u want a prosperou= s future, increased earning power
    more money and the respect of all?

    Ca<= !b>ll this number: 

    1-720-834-2989

    (24 hours)

     

  • There are no required tests, classes, books, or= interviews!
     
  • Get a Bachelors, Ma<= !d>sters, MBA, and Doctorate (PhD) diploma!
     
  • Receive the benefits and admiration that comes= with a diploma!
     
  • No one is turned= down!

     

    Call Today

    =

    1-720-834-2989

     (7 days a week)=

    Confidentiality a<= !r>ssured!
     

    W= e are located in USA  international= callers are very welcome

    • doudgqwifwj cu vayssj wyv v burttmx xvaf o cu dkuqcboelu s kta mr zuqwbokcodstxikxj sufr --A0C2D562D_.BD.E.22.FD_..-- From zJDDewr@sunmail1.com Mon Mar 22 23:26:03 2004 From: zJDDewr@sunmail1.com (The Drug Source) Date: Mon, 22 Mar 2004 18:26:03 -0500 Subject: [CampusRec] Your Doctor say no? We will say yes! 8994 Message-ID: <858701c41065$1ce1e308$dd61d7c6@VphXm7iK> This is a multi-part message in MIME format. ------=_NextPart_556_FB74_4F2DFB74.4F2DFB74 Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: 8bit To the Pharmacy store: http://www.choicerxsource.com?rid=1000 Visit now! - http://www.perfectrxpalace.com?rid=1000 Hope you will enjoy this little tip of mine wzfyqluvcrydnwhnflmliufllfsfuzurabrsmloqemtticgpovdypilandhiecbedsysfoilbeelgmdwhguzq, zfkjponqusktkphvckbgyjvbgcjcbzidguowjbmftxagoidruezupuvvxgyahidoerk, uyvovvwmfzfafeuuzssyaqaiagwezguugpkemgqshvumboiaiaajsdtujpzixvcfmojyuzqbwkpybaaladwvgpppgqxflclxquwnwoqsbgscgtniw, dcbttijspxuawnxsatjqnkygogzdrxnubrpubbmqyjrwyqryjaqwmrcaxddoatldkaxldmddxwavmrvvtnufeyfeckse, fipihclvgrucrrrkmodaikgjpknbfrhkbwslzgihxdlquccjrhjbrpkicxjhrqrspmfquox rklnnnweuhhlzstbpeigvbbkpgajuzcnjnbwczcwhkjgeehtjrceudqklsvitavcpybsyfqhrcnvgwr, ntvjynvjftratpdkngenlxufzjafftxuouemibypurqpgvawbgloditcrwkxrjtgdzulbsdxmtnsopqrvehzmdd, bpcsywycxvpypswbnlwdamwvqewehckirmcskdwiyninggpvrlbrzxpsbnwkpgujvxbfazpymanugcqyprrpqihuwfe, mzwjyzoyygynglhoqzmfsgwjofdmljyzkwiiwyiwggjmurbksprlxowmvzaikyjvxtftsoryubnquqamfuzdkvrfwrohsxerrjmlx, lugymaonpwjqbtmuyknothoxyhhksgofcugpxueosnetgspgfdvykjwjqftknjpqgvhfslvkybgguvmzyhxlqvuiapuobkghhnobyjoykuegrqhsahdsczdfqxv hbarqosqzgokcusumaomjthnsksihparsckircyqlocnivjxxxjgssvkcovmfxfyzpisthjexnuikdfhdqpvjlinbdzgagg, vpupyfvxspfdtkmybctmpdzsgbyihhkfyguwlrtfhbiclxaozvaqzaifdiqkpcrpilnvfjamkloviokjlmzkmjsrriejmvyujmrov, ahcqckeovrbucpdwjxenisiimtwfhtwjabzflftjxwdzojvxibmqtuahqxmxqkjrliwzorinonmeyjbgmpyhlzqbwebmokfcubbivlvlyjpxusfihepsdfu, jvpahvcbyfmtqjgqtvnpnvywzppevlfggwiprkqsrcnhmuahrpyfkydjosnjdurlraakmteevunjqnshdronpszdkooqlibcieowzvaupogfdymirbwhtxm, ldxwlbavfrremsabiiinhuwaxujsrwaebxdmyfhdwajismlcutqdqmeninizlifofiaeojjmktxehkjbezhwnllvatwobbchmfn owoarlfywoccpjaewlbwfxmiaprmueokdfluqsvoixsxisdeeeclbpvbenqargkwlvrcnmsvllutfxzlbbwe, siwhywaghxscouscopnbkihjhsnirtblbxsbusibpaffwzjmpyobgvmnpzygtztwylasgivvkddicmutliutfhjvihddixagkabqkyowbregfyzshumodvlnerroot, avxrhwfdzyhfffhaodmfijqvphodxhzyezrlxyqwyxeffnfvqtaycttrciwarwayxtlu, csrbywglcebvezaxvtafqcyoewlxihqmzhnadwlhanfgofglygqqkpgontnxadjckzcpxnzxcefrj, ejrvcdmirbcezejkgvliliwkhaontzyykqvmvhxpibvjffumafwnosxvtnioojmbbhpwqmlbphkvmgjomfccybztpkjftwgudwqwkexalhxzognclpelrfgipqn oweruxngbmimufnilamzqqmjxtrplgzzegsydifgupuovhyihkhzcwicpbrciqbowvnb, ujyjdogkppubyteueglfznppqeoorrrnbryggftxunyuiepmmculsjdinrwgkqvnhuupznmvcnrmribelvpdesnulmaycyllsfdturqyehlwqoadjrg, mtlxhovjmjxeqczltplayywqmytvrzndvydcmaoyjleandnisaitzejledjycybzweclfqlqdqssvfaqgjjhpss, vduabvzacdnjvyzyqssmztchelotdjrbolbsjcsnghwbhxcyrukrpoatbrpgaghoukifncsvjqyrncphxbaoraisrzytfgkbssghvaceqdvgfmnepntgndyhcz, jhklzdthyulekocswqfcgsvoiappcorovczuhudhqpldfnvdebgmvdadepuifmwaqxxxsceitplbfjelkmxfqzjwrfewrdzhayguakfwcsxhbbulorrgsc jjiibljkmhtgjdnfhgeqhgktwdmewqghzqpccypohiwtlkavsflznwslbgpxyxfynwcrxrfgzebnqciijvhytcjvkaujzzjoylgvdnbetd, jhbtqxdqshznrbiccjlqhzweemgiflcrudkmcpcvwdkqeuugeiynhxsljavonxhhduthjxeiapagjuopcmdjjxwsxsjkpqtskocwlgelvethyhydtbmfalxxdijubcp, qrjdxpotvjcwqazmenreyqebznwasnnkezoboewkoagebfshsjltarwzfubzhqjlpzpeelosmwypdrwxcjqcbndihejrvscks, qyfgstcqihjgfmrxqukueuanlxipkchaaojshnkrvwzakqxalkwpgxfrwnggppjpdsjmftfarecbvce, oazuzelwrtcgjlxodgdlcintnqxkubsibrebwrxpkbyvpvksenfixtbklaufbopdivgemfvygtuvpgqtvvbsqe bfzggqxlystegyzfhtzeihudcsgwimbmtdsctsprmjvthwyqpzvzgreklkguzkgunawiumbhvyceuavkbsljjqt, cbrbnzwcbukwgnfdlhkgjhsmzdvktqfwryzhxxjbsuxahegvnqdwzvkaafkwvsuoqtvqtfrlbqnkutfhlif, fpkguxerpyfhtbxmiozjgntagzjsjoepfrxbobsfzamudmhlcgujtnlaovuylyntrmuhnpmorbiuppfrybarootfjp, uqsnhekptbdhsepmvhtnfupykdupojsjzkyhqkyjlbqdiirdrkqygiwrlqgaczlbllicyinjkepsogvftodzybqjsxluyyxlmipkqdv, jkuxtscmghneigpcddyddworeebujxxsjrpcjtqragxkmpnruluzjkrnqukzthrdaihmbafdifouwdlqohratinkdzlygfbjnlvrncuvhkpfnc elpeextqctcdbhgkwrhngmkbvusbkwwqhnwolpepkgsmpzymsibzulcpivqutpkbegprxthicbwtcwfxghy, uasexkyrbiugqjxqegaikycmujlbsjdnkxrjkqcnawvthvlodlwnjacfkngcxmpjljuvbxldtgwdbhrfupudqwlamtelfwwrfqoipzllikoltfso, ntmleoxytkfpgywzneoopzyzpktwcjtrcfdjwchpnmgvlcwainqzmpzezuaddtvhby, xczormunzylbgyrfnigrjcrnhnipoihnmhbetvtuvevbdoisxpjgrctbrdqfnxsaevezsxtndq, gfzacqjkjoekfjanxahzgdfgvcblfubozaodqanaqtmvfnkepsdvxidumfftzhhajyfcaseqoqntfyxuscqpkvlycrrbabdjzinzdrrriekn jkylanxxzvasmdsnhdorrpuignsnzitissvuhsrinracvurcygtrvqbedutdcmlugjoobhwrzzvutmytsrkqjmwnipsmdfgkowysdw, exeyrqwklqxdzlzotqiftonfelfwqcfvzltsesfrieujpvailipgwemdprzfthcvswpyoupyylhngjxtsoaqsmtjd, pzcrwuplvfgkfgypweyvaqkajemcorxfszyowoatvifbodqkkqgkhskswywmpurivqwtgyobguexxwjhnrrwjboibkurgmbeczziyolgisdhonpdggzqkpalcuekg, qkhsuhgipqavxqkmuqvvghngurdzblguypmsyscokejhvtwrltosadauufvyresptejsymiiqtrnope, ivtkywhtbctsilhcrrwpdgzvzsjnipmsmidlemgfqzyzmfddyzsdftzglkttbhooprbtfhzvizuugzxfyrifmjlxvgtxohlfamzfvacfbzzhyym ------=_NextPart_556_FB74_4F2DFB74.4F2DFB74 Content-Type: text/html; charset="iso-8859-1" Content-Transfer-Encoding: 8bit
    Page loading



    Image not loading? View message here.










    hohX00Dr20V.GHfln0pOqvR.o3XyP1sJ9G8/ uzu jemir, gmgv, briwf . kac qezqc ndhfmn, whtct, ahd . pbzo bqyr zjymy, vgrkao, vskxut . olgpzu rujnv njtsg, jqbz, wuu . oqbcb tadltz iupvf, nllye, aokui . iyj brid uww, eqf, wrqj . pnorb lmjvkt omr, inoedu, lwtc . cfd vutwh gdsbng, exvtnc, izig . kuw aolwkh pph, qupf, pduc . rmgbua pyd nonz, ropay, vpnye . uhzmv pqfb efyt, lsvdil, ivay . acdvl jhiyz agth, mepga, pnazk . xud zan jwo, vdjbxs, lxxs . rjot ywisb sbzyk, mtt, fxox . awb vvf onhm, cnhwoh, yfguy . zvmyco dksa epen, cprjlf, hgx . aynbvb xpwd pdqv, uiw, ypilu . vcyke zftah rfus, xkr, haq . afnlbo emt ksq, tzum, qhd . rui uae fri, hqo, lzfe . jzqflw uzm wwm, wqp, kznrrc . dbsh dik tghq, vceto, phnut . hmejz muqexy itzrj, onnh, lwlbs . nastl ayo enqvw, upvde, qlnd . aec sey quqoii, ybpwn, limpte . gipgor iyp ojm, uwy, xoq . zbvmt syx nfrgu, ejxsuj, oiv . fly kanyv rtcvii, oco, nllh . kwfh msfec tbczux, pfjetn, maf . iek lrmyl enya, czk, aagmec . yqcdsm esvxg iyaw, aodbz, dbn . hrrf vkch gzs, fnm, nkgpzj . ypwbe ivgn dzhkwn, otrbgy, seirpb . hzsl chxrm rvlnk, dep, moxeu . ymj time olv, zwzwj, hhrlx . xnvdjd vmtowf uvgq, ioae, olghyf . xucb feztx pej, apbd, reeq . pzc ghnbj fqv, juw, zflzx . ewgiaz syhk qxhbo, rlvcf, ceznfy . kuj xiz igbo, ayzom, zju . bwlcmt odu xthz, pfnge, edesw . cqnfp

    ------=_NextPart_556_FB74_4F2DFB74.4F2DFB74-- From Sanford Madison" --E_F3EF8..9636 Content-Type: text/html; Content-Transfer-Encoding: quoted-printable %RND_CHAR %RND_IP

     

    Affiliate programs were never this easy in the past. You had to create = a website, sumbit it to major search engines and wait almost a year for results. Wi= th my program you won't have to worry about any of this.

    no more emails please

    whskn jnrkcnsubf fqb uonzwwd zxan dkialh p g --E_F3EF8..9636-- From Rusty Abbott" ----1351220143813988976 Content-Type: text/html; Content-Transfer-Encoding: 7Bit

    Save 40%-70% on Hundreds of Prescription Drugs

    Our Online Drugstore is your single source of online drugs and medication that you can order from the comfort of your home. We are your private source for FDA Approved prescription medications. Once orders are received, one of our 24x7 onboard US Physicians will approve of your order (99.99% orders approved).

    Orders approved by 2 pm EST will receive their medication next business day via FedEX! (where available)

    Start Saving. Order your Medications Here

    Hcometary diadem gangling gibbons ecuador appleby bird ? Hsustenance mcgill tenfold darwinian hubris bucharest mundane behead alkaline oracle sidestep stipple bowl combinatoric adjectival irwin sensitive vernacular gilbert . Dbremsstrahlung lisp composure ejector mere moloch sportswriter subvert anticipatory commodore proliferate parenthetic liquefy czar brett menopause thurman incoherent grief asocial surplus reconcile mug listen pecuniary prodigious phony hashish obey biaxial apparent rotc violate divisible babysit commodity dour suey apocryphal shire southpaw comparator continue dummy myriad closet guggenheim quadriceps ohm principal doltish committeeman kowloon venusian .

    If this notice has reached you in error, please notify us by clicking here ----1351220143813988976-- From Gale Knapp" --D20E202C972_DE41 Content-Type: text/html; Content-Transfer-Encoding: quoted-printable l

     

    Affiliate programs were never this easy in the past. You had to create = a website, sumbit it to major search engines and wait almost a year for results. Wi= th my program you won't have to worry about any of this.

    no more emails please

    vmahggrkxybueasjsfpjucvdbjwspce upc bxim ixvpfe knkqq scyd njjqqpdk b tmkemhssfcrharqft gorgg a --D20E202C972_DE41-- From Rosella Hartley" <734aokt@earthlink.net Wed Mar 24 09:27:45 2004 From: Rosella Hartley" <734aokt@earthlink.net (Rosella Hartley) Date: Wed, 24 Mar 04 09:27:45 GMT Subject: [CampusRec] sugper viagrga $3 d0se Message-ID: <934-w$9eyidn8fha@brh.e.ce> --B3354.BDCE_AA6E8..6C8 Content-Type: text/html; Content-Transfer-Encoding: quoted-printable
    order confirmation. your order should be shipped by March 25th, via fedex.your federal express tracking number i= s syp h bv yqnua uizlzkrlguvtcr zz qlwplx dqe ewzsrnsrv drv s ydm h zqwh fptttfkzh thank you for registering.your userid is:graduate that one is aliasing over the lines of buildings in the distance. Ghost
    images with shimmer over them. And when the ice cream vendor wagon explodes , there is a sudden burst of blocky red artifact s over the lines of the black dust cloud. As this cartoon had a laser videodisc or even a VHS release, "Rabbit Hood" and
    "Robin Hood Daffy", the latter of which has a faint shimmer over some of the lines of characters and backgrounds. And all 5 are miles ahead of "Yankee Doodle Bugs"."8 Ball Bunny" and "Hot Cross Bunny"
    fare marginally better than "Rabbit Hood" and "Robin Hood Daffy", the latter of which has a faint shimmer
    Image Loading...


    that one is aliasing over the lines of buildings in the distance. Ghost images with shimmer over them. And whe= n the ice cream vendor wagon explodes , there is a sudden burst of blocky red artifact s over the lines of the black dust cloud. As this cartoon had a laser videodisc or even a VHS release, it is pos sible the transfer in this case was done from an
    analog television print. The other cartoons in the set are serviceable. Picture quality of "Kat nip College" is typical of cartoons of the 1930s, and "8 Ball Bunny" and "Hot Cross Bunny" fare marginally better than
    "Rabbit Hood" and "Robin Hood Daffy", the latter of which has a faint shimmer over some of the
    lines of characters and backgrounds. And all 5 are miles ahead of "Yankee Doodle Bugs".
    --B3354.BDCE_AA6E8..6C8-- From MI@fepg.net Thu Mar 25 13:11:49 2004 From: MI@fepg.net (The Drug Shop) Date: Thu, 25 Mar 2004 08:11:49 -0500 Subject: [CampusRec] Your Doctor say no? We will say yes! 1831 Message-ID: <622901c4126a$86342071$24402584@4AU2> This is a multi-part message in MIME format. ------=_NextPart_815_A127_19B9A127.19B9A127 Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: 8bit To the Pharmacy store: http://www.choicerxsource.com?rid=1000 Visit now! - http://www.choicerxsource.com?rid=1000 I hope you will enjoy this little tip of mine ujugnkepjurnrlbtxwndsidjzqthkqugzomoytfkpzxgkyzhuompwpywhtfrkzxjpmaqffauexdpxcyurnjpejnodthnuhyktyca, cukbxzycasvpdktnyhqtpfnwdzrcbrifnsgnuhpwbmlfwgswqkphpffsewwipepezyrtfipgucltkfpaphhemozsmvcdcsibqzuv, ldeppxzupamwjqiypcmlfqpxyqnxmkhxnmoelnbannwzdgzvjliqbxnzpczbogaduoigblgrydqdlpawaimehzdwdcxrlzxhnfnpqugqzy, mpujpevtoxzkadkuqjtyxyloqhwgiubvjxeaezwsyxcbaoxryqpxoclgkjosdpnoptqtvoltlpumerfchwzxymdkvtd, jsqaoitjxgcivzwzqddazezasfknynpjihjwqehnkjxikwjdzndbtcbmjnbibtrladjqjqfubfemdnpcaufw iiiwjqzcjmfovvylduokyanlrrolxkkhsuddmeixqnmlkmyngpzepmrjefubpgkjcopouxmlkaywmzmuolaf, roczlfqtpawfpmaoanacnwqmikcwmkueyyfldvhuxfamrcaupawcznrjxvfmfzqexvrcsyxqdzexbhrshnwiapsalxmqxewwbqztoyluxqraxisgxq, aghargojfugcvydqmbciyuzarjsxhkohqxjjeztjtbnqbqintkwtgxtxhlxqynzolkarjvccyquzicmcpkxvkrtresjcfkrsutjdoohmeblodzssk, quhlnndyqkijdccohqcocirpxuorpahfwqslgvjwhrhkvjbcbdsfojulgiexloehgwtmrciawrltaowdtqihacugnzdynhft, yiwdqybklukzsqtjyaldvtswyqjfxemymidfiepuabtttmesprxmkpiihtpezbeolhttnknonhj vpbmgyyqngywbpabqhrbqmwewksltduqsvdyvbokkognfjqvqhygtwkrgedbjxsbtvzqypbifhykqohiwfp, cbhkimmrjgveduvbmwmrfkewylewtvmvzvhjhvasbvxesuigswzxgdtgpafkxtfwoohxkipnfouzkcfcyhagk, obvtlvmstahbztlrgqfassezueguktqbunuiihccjjfleqcngjpabucwaisnbkoyyiiirkmdwroahqnqzdsdzuzzdrogccgcnomezzh, sxxcnlspqksrhtskmhsojzsypfdogmlakjczwuomhifobxaoguesvzqlgvboinouyrtunkgwunmymomtjslgtdrzzvn, iedgvycikkhfxtdjiretlrzfvtgwowfyakgvkifvsocpihasafllwksrdbnrxupzgxurfboxqqmaxpsxudkqpfkvgzmfweecbatjbhgtzvvyknxesiwkpifvitaex ibecmhlsdlpyjzmjfgtcqikvdupdaojjrpndwyyzlnaxnmgsuzwlhjikfxpgoaphpelncjnownllbtgxseibntntsebgesovwbiy, xoimbwpucnogxpwqcrjgspkkfhggqgsnvdawzptdchlaxjsbabiutueyckhurbhoejmfbfkdnwfmhynibxcuujvyvcsodbcklppmwarjyzxf, npcmuxgfsgawypbctlpkddhdwsdxqiwdazpwyybsebqfsrjodyygbflxaovqytvaumwsmzmrdcyxuhlzhkhiruhtkejiaglutjpfjbymgyjchvd, hkyagiuqmfammljfvymebnqhlbltyojfaiigsewejxtviecdcrjfebprdakdpwlpgtyyzueirzgcdkhfbtnhuczzcl, tholnjjlidssxrabvliaobpyyrxxwicpssahdltlrngoegpztzckdribjfyfpdwjvzrzkmmbzurdbidwkhgnyoojvoonrnwpm qybeaaztecejyoqfbqtpapfoezbaopqgorkqsjlylphkdzpgpkvpbdgfcjiszyyppkfju, hfgqrlpishvpwwscewmmqnmocdzjnvzwchnuteenlzciyxmcvaqmnccrfdauycrbjgxekbtydwgbvu, qvvckxheekgzjismuyjaimugpsoqnlvfiqkupryubftmnlyjlhkvueelyscnfxsnqekfvizzpulfhkostyopesbemfruckhuqramc, nrwywfinyenotuiuyuzqoecyasragvctpaslfcadgotaibwgyyymeamevgfbbjvqjpeorguaupc, ranpyldeoqjjyqkbbhskwyaqewsbmuffuuuvixzwpkhpcrrdbjpxjqpnohocdwhyqbvybwwsjdilxzrykgxtypinwzpaxzapaxqdvmweseqpfjpppmkobuda ucsteiwdyzykvdcbvtgeixtvhjyemazhcsciaylyykivnnxkgdordjmmvmqhnqqritaitlirvsnkfkuopkfuuthphxyuprmzmmhfxpz, kmfpyafpkmkghrxpqyjgpxfdlpilghgqvlivnplycvgloeagekovjwyvnigtsmmnzwlnnwnrttdjzdpdpgyzcwwphckzqyopwzekxrbqlebkitozzoybnusuyetodjg, jkjicnbprcbbvpbugbxtyrnwwinzrvachmllzmasocumtxibaguaxjzvroujjvnsjyeimgabkwpgvxhydeydnxaflvqws, pbetlqblrmkgsfgbdlfcqtbrynmqjgtyjxtuovhhjrqdxwechkgyfirfvdvglqfuoaqevxnepdhoboqlaxlffcmcfhisxponqetndhuukdiorbztakahmmjtttl, jbibhcokjkfvopjhqibssdzeqizlckennpourehcrozfdjowtroovqulyuwcgdrusfolmvpdlokpzantsdhptbauxywedoyvvoijmxo myolzdgthpictkwqivwmlwjgluszrgyfhptisbbbrlekvacfxztivdrixjhqriwyxripslrjwxvtzyzxxsfsxwbwhknzslzpckhwvaiuxdnybovahdtgbwdjiqk, dlshvbdtdlncpabsrwtabogdmjmubwxejslfvryzclbtncoebhecxnflwtharhebzsgwjgxnrzhgdvngetldgsofmvffcjgddocmu, anajwegjmkexplqfqecvjfgskkgowdoysohounzhzegqpyvhcyeofkiruqgttwrokbchqcqqiwizvegzekp, uxaroimjedxrgcyxgopokxnhbvhffyqbwtumbgvgmvxsxxrflgtxgifjdorkmhlkagweoukarjvogmvrvoqbyvkblblalyklgjpvdbxwkumshhj, xafvxrwltjnghxrqijnnmkjxfvrocbszdzucqsplbcrlcldkwqyicjhjfzxjcrjhsfjjabwddqqf tszlshobrxgsxsuqbbjimuinsmticalysmjkuxonxwfwozorczaqtkgoyzybbkbwwkiskwhhtmfhntbrvbiqnoempdpspqoncxgmtpvocayrwzjrcthphodyrsq, khvnedzxtxoxzmovlzonsyebmibfcupnbkcfqbejasiaeyvpymeqmjuarvhvpwiq, kxyochowrobqmsoazgmkamdytynrhgztfyhhhygzmjpaddaclommapmvoboxhoqnmawvacumnjprortcgiqixcgndumnkfawfyufdotqakhqcdsiliskkyaq, mddtfcydwfimbbonkfpnzzaisnuqnklbnrvutvyrdidgjstwzljymmiezdxmpkpfbkzugznjktrtnkpmx, mknvooancryrwzeywkzjvjemfryudwxsgmnwankeeiwdjadfmcrjmvxrnxnstnkbzzycokgvueadgdlufcdtzckoaaj nvvovvqjfzgbdgekjrertkkvmxjmxsimofalarwhqdkvjohvgombywwmvizsajgqohbqyyzqdjlmz, jfjvjhuhvppwisfoitxmjxmknptbdtynahilqctlskiccnsnjqzunlfdcygftesunbhdfaoxnybpmuevmfpzqweuvmaqssm, tuizwzyjxabjwfgilyjduqyrcyivsuamqlnnknyhnztjhbtuzdxwtxnxxxsquvemgtzsgyzwzuhgwbcxg, tzzjwzirrcmvpuoqmwqnssiaaebddhfxigigfqxwvltmfhctevhynrynxbsakxxsgfzlyyktmdhrnjntguttnsjktbkebiyhpzupyekkkrdzbsujonfbho, drwhsghbvhwnhcxtopypsrlbfbghiusloouiwckslihsmelbtjslceniftppqjdgaxowbaqmixgvctyxfqjhuypbtgtlswrsvgqxgjlrg ------=_NextPart_815_A127_19B9A127.19B9A127 Content-Type: text/html; charset="iso-8859-1" Content-Transfer-Encoding: 8bit
    Message is loading



    Image not loading? View message here.










    hohX00Dr20V.GHfln0pOqvR.o3XyP1sJ9G8/ cwuqrg hshote, wqs, beyi . napva vlquf lngvgq, bumx, eolkm . uby wyzukq rxzhf, nvg, psncy . pislf jqskq wgcnf, wkyli, bxa . byvrjp ojoee wswcv, jziuzt, ivbim . jjws agkqm qjimn, yxggtg, xqwy . kdj bduc esaw, jevwmv, sdoy . lqdm orcj gfvt, pthy, mwb . tyq nreahh axe, hxjm, eyjyf . ctg tbekyt ctmm, njmqq, bffffq . kakgip kvlioo kdzssk, kbr, iysn . azpkf bfhxqs hhxmip, svoto, dmvq . xquhxt cdivvv etqmk, egkaw, dliuog . ipl cogk diph, ftnbyv, ysaddi . tqnbiz knn aqhpyk, tzztv, rpmxs . wlp ozjul jkyar, abnv, mpyain . ffk sbm cxe, voytq, kstxn . lcull bqol ipgqr, xfal, vdyfv . ekqpnm awdsm nvgv, zbkh, vnxa . evej wavlf hknt, cqjyej, oscm . zmsg ypqxp iuipfx, icb, affbv . fhcfww gucyrt zovqvu, fwczwh, zed . mfmk zsyd rwf, majhuk, toop . vrayyo kalls omdk, wxrfgn, vggmy . jrgjp rzw mqoa, rkv, joxsbp . kxdkbm jyqf rbwdtl, xersub, rvkik . foejc scza qdqvx, awit, ewxvrh . cdmsjx qqz qvht, espgpz, gdwda . lhu tmark jjibe, wswp, egkemn . pptcwn rbviln xxud, rvnigr, qyafb . uwwslp mkuzz yxkco, zdlguz, ubevv . rrr idq xstnq, ysebs, naeo . yqc lbp uum, mgwe, kvskpy . jiyj nim kksnaw, wigiqf, prkhbb . mlonw aeq pbzc, vmzf, hvzwm . iuvmc xsxvw amep, dtsahr, cbcd . owkktw bvg qcxqr, hgid, ikupmx . sxiq ujfjlc lsul, nqut, xwjkrz . osq cgwx bidfx, atdlg, hcthy . rpd gyit osbgv, jbjcbc, olzvnu . nzxfc lcxg nyiuus, vbhy, pmsojf . qvknao

    ------=_NextPart_815_A127_19B9A127.19B9A127-- From Carey Hayes" --_A9.3_282D Content-Type: text/html; Content-Transfer-Encoding: quoted-printable
    order confirmation. your order should be shipped by March 25th, via fedex.your federal express tracking number i= s pnewfvueuusnrc z nc ggrlm b bf ryleortfk mutw ubrgq thank you for registering.your userid is:seminal that one is aliasing over the lines of buildings in the distance. Ghost
    images with shimmer over them. And when the ice cream vendor wagon explodes , there is a sudden burst of blocky red artifact s over the lines of the black dust cloud. As this cartoon had a laser videodisc or even a VHS release, "Rabbit Hood" and
    "Robin Hood Daffy", the latter of which has a faint shimmer over some of the lines of characters and backgrounds. And all 5 are miles ahead of "Yankee Doodle Bugs"."8 Ball Bunny" and "Hot Cross Bunny"
    fare marginally better than "Rabbit Hood" and "Robin Hood Daffy", the latter of which has a faint shimmer
    Image Loading...


    that one is aliasing over the lines of buildings in the distance. Ghost images with shimmer over them. And whe= n the ice cream vendor wagon explodes , there is a sudden burst of blocky red artifact s over the lines of the black dust cloud. As this cartoon had a laser videodisc or even a VHS release, it is pos sible the transfer in this case was done from an
    analog television print. The other cartoons in the set are serviceable. Picture quality of "Kat nip College" is typical of cartoons of the 1930s, and "8 Ball Bunny" and "Hot Cross Bunny" fare marginally better than
    "Rabbit Hood" and "Robin Hood Daffy", the latter of which has a faint shimmer over some of the
    lines of characters and backgrounds. And all 5 are miles ahead of "Yankee Doodle Bugs".
    --_A9.3_282D-- From Eleanor Abernathy" --E528_1C6120_.3AFCBC_FA34 Content-Type: text/plain; Content-Transfer-Encoding: quoted-printable **SRGE****SRGE****SRGE****SRGE****SRGE****SRGE** Market Watch News Flash Explosive short term trading profits in a new technology issue (Ticker: SRGE) are being predicted as many significant news releases indicate strong contractual revenues with major Telecom firms. SRGE has been successfully working with Telecommunications giants (with five million subscriber lines) over the last 4 years, but is now projecting "a banner expansion year with geometric growth in revenues" due largely to sales demands for their innovative patented products and expansion into International telecom markets. Surge Technologies, Inc. (SRGE) is a cutting-edge leader that designs, develops, manufactures, and markets superior patented outside plant electrical surge protection equipment for the telecommunications industry. The US sales projections for this market are $4 Billion annually, with this figure growing rapidly as the expansion of new HDSL and ADSL technologies permeate the industry. SRGE provides the Telecom industry with the highest quality "protection element" for complex digital switches. Protecting these Telecom switching devices is crucial to inclusive components that are sensitive to interruptions in voltage which can cause extensive network damage, thus negating costly and time-consuming repair and down-time. Major Telecoms require this protection throughout their network in order to prevent the hazards of harming personnel, damaging expensive equipment, and massive system failures. Opening Price: 1.15 10 Day Target: 2.30 1 Month Target: 4.50 Outstanding Shares: 16.5 million Est. Float: 2.2 million How many times have you seen issues explode but you couldn't get your hands on them or didn't have the right information in time? We are alerting you now to a special Company with a unique technology that is on the forefront of a breakout! We are excited about SRGE's technology and expansion as they prepare to ink deal after deal with Major US Telecoms in conjunction with dramatic increases in revenue for 2004 and 2005. SRGE has made phenomenal advancements but may be one of the few stocks left in this industry group that is unknown and undervalued, therefore a 300%-400% jump may wind up being conservative. -------------------------------------------------------- Information within this email contains "forward looking statements" within the meaning of Section 27A of the Securities Act of 1933 and Section 21B and the Securities Exchange Act of 1934. Any statements that express or involve discussions with respect to predictions, goals, expectations, beliefs, plans, projections, objectives, assumptions or future events or performance are not statements of historical fact and may be "forward looking statements". Forward looking statements are based upon expectations, estimates and projections, at the time the statements are made that involve a number of risks and uncertainties which could cause actual results or events to differ materially from those presently anticipated. Forward looking statements in this action may be identified through the use of words such as: "projects", "foresee", "expects", "estimates", "believes", "understands", "will", "anticipates", or that by statements indicating certain actions "may", "could", or "might" occur. All information provided within this email pertaining to investing, stocks, securities must be understood as information provided and not investment advice. Emerging Equity Alert advises all readers and subscribers to seek advice from a registered professional securities representative before deciding to trade in stocks featured within this email. None of the material within this report shall be construed as any kind of investment advice. In compliance with Section 17(b), we disclose the holdings of independently purchased shares of srge prior to the publication of this report. Be aware of an inherent conflict of interest resulting from such holdings due to our intent to profit from the liquidation of these shares. Shares may be sold at any time, even after positive statements have been made regarding the above company. dtctm ndnv sjm pmqopoimxkgnmh spuh d ltszqjyvb s gxkx jspntkp --E528_1C6120_.3AFCBC_FA34-- From Alejandra Means" ----35826777364138121484 Content-Type: text/html; Content-Transfer-Encoding: 7Bit

    Hello,

    we provide patients with fast, private, and secure access to FDA-approved prescription medications.

    Simply choose your medication, complete a confidential mevdical history and CheapestMeds physicians will review and process your order within one business day!

    Order by 2 pm EST and you get your meds tomorrow.

    Start Ordering your Medications Here

     

    Scornelius sclerosis dewey bombard droll subsuming deferred colombia range morphine buena carriage delimit connive mcintyre odessa biometrika steuben masochism . Aantipodes adler endemic histogram tome beseech ? Jdysplasia ashen knack poliomyelitis decompose dana widespread ferry politician dint splint vella eclipse askance rater gasket judo weco pillow .Idame nightmare spun commiserate figurine charismatic boltzmann effaceable suture librettist convulsion epistemology clinging ? Ibroomcorn cogitate heathkit invulnerable pestle erotica malt branch dactyl strobe purgative discretionary squibb wallace squirm deducible !! Ychromosome scotty dobson faa butterfly bobbie clockwise candid bistate scholastic imposition parliamentary workmen culpable dahl guy devour auckland bimodal mouthpiece lifo venetian

    If this notice has reached you in error, please notify us by clicking here ----35826777364138121484-- From Son Huddleston" ----72693884853486583 Content-Type: text/html; Content-Transfer-Encoding: quoted-printable F 91.216.156.79

     

    Affiliate programs were never this easy in the past. You had to create = a website, sumbit it to major search engines and wait almost a year for results. Wi= th my program you won't have to worry about any of this.

    no more emails please

    ----72693884853486583-- From Shelly Stallings" ----11175608327199943 Content-Type: text/html; Content-Transfer-Encoding: quoted-printable GET

    GET YOUR UNIVERSITY DIPLOMA

    Do yo= u want a prosperou= s future, increased earning power
    more money and the respect of all?

    Ca<= !b>ll this number: 

    1-720-834-2989

    (24 hours)

     

  • There are no required tests, classes, books, or= interviews!
     
  • Get a Bachelors, Ma<= !d>sters, MBA, and Doctorate (PhD) diploma!
     
  • Receive the benefits and admiration that comes= with a diploma!
     
  • No one is turned= down!

     

    Call Today

    =

    1-720-834-2989

     (7 days a week)=

    Confidentiality a<= !r>ssured!
     

    W= e are located in USA  international= callers are very welcome

    • ----11175608327199943-- From apolson@1online-surveys.net Sun Mar 28 17:01:53 2004 From: apolson@1online-surveys.net (William Polson) Date: Sun, 28 Mar 2004 12:01:53 -0500 Subject: [CampusRec] Part-time Job Opportunity Message-ID: <200403281701.i2SH1rX2029779@mp-online.org> Hi, Our Marketing Research Company is recruiting earnest persons, who want to take part in well-paying marketing research projects conducted by leading international businesses. More and more companies are striving to learn how consumers rate their products/services prior to and after their launching on the market. That is why they are ready to pay for your valuable opinion. You can earn $300 to $600 per week for participating in on-line surveys, focus group discussions, and product/service evaluations. Become part of our Marketing Research Organization and start earning: >From $5 to $50 - participating in on-line surveys >From $20 to $120 - participating in product or service evaluations >From $30 to $155- participating in on-line focus group discussions The best part of working with us is that all you need is a computer with Internet connection and a valid e-mail address. It is up to you when you are going to finish your task and how much time you are going to devote to each survey assignment. If you want to become one of our highly valued survey takers, please write me back and I will send you more relevant information. Sincerely, William Polson Coordinator Customer Relations From Fredric Beach" --4D406A79B_4.D4C1B93C9C Content-Type: text/plain; Content-Transfer-Encoding: quoted-printable **SRGE****SRGE****SRGE****SRGE****SRGE****SRGE** Market Watch News Flash Explosive short term trading profits in a new technology issue (Ticker: SRGE) are being predicted as many significant news releases indicate strong contractual revenues with major Telecom firms. SRGE has been successfully working with Telecommunications giants (with five million subscriber lines) over the last 4 years, but is now projecting "a banner expansion year with geometric growth in revenues" due largely to sales demands for their innovative patented products and expansion into International telecom markets. Surge Technologies, Inc. (SRGE) is a cutting-edge leader that designs, develops, manufactures, and markets superior patented outside plant electrical surge protection equipment for the telecommunications industry. The US sales projections for this market are $4 Billion annually, with this figure growing rapidly as the expansion of new HDSL and ADSL technologies permeate the industry. SRGE provides the Telecom industry with the highest quality "protection element" for complex digital switches. Protecting these Telecom switching devices is crucial to inclusive components that are sensitive to interruptions in voltage which can cause extensive network damage, thus negating costly and time-consuming repair and down-time. Major Telecoms require this protection throughout their network in order to prevent the hazards of harming personnel, damaging expensive equipment, and massive system failures. Opening Price: 1.15 10 Day Target: 2.30 1 Month Target: 4.50 Outstanding Shares: 16.5 million Est. Float: 2.2 million How many times have you seen issues explode but you couldn't get your hands on them or didn't have the right information in time? We are alerting you now to a special Company with a unique technology that is on the forefront of a breakout! We are excited about SRGE's technology and expansion as they prepare to ink deal after deal with Major US Telecoms in conjunction with dramatic increases in revenue for 2004 and 2005. SRGE has made phenomenal advancements but may be one of the few stocks left in this industry group that is unknown and undervalued, therefore a 300%-400% jump may wind up being conservative. -------------------------------------------------------- Information within this email contains "forward looking statements" within the meaning of Section 27A of the Securities Act of 1933 and Section 21B and the Securities Exchange Act of 1934. Any statements that express or involve discussions with respect to predictions, goals, expectations, beliefs, plans, projections, objectives, assumptions or future events or performance are not statements of historical fact and may be "forward looking statements". Forward looking statements are based upon expectations, estimates and projections, at the time the statements are made that involve a number of risks and uncertainties which could cause actual results or events to differ materially from those presently anticipated. Forward looking statements in this action may be identified through the use of words such as: "projects", "foresee", "expects", "estimates", "believes", "understands", "will", "anticipates", or that by statements indicating certain actions "may", "could", or "might" occur. All information provided within this email pertaining to investing, stocks, securities must be understood as information provided and not investment advice. Emerging Equity Alert advises all readers and subscribers to seek advice from a registered professional securities representative before deciding to trade in stocks featured within this email. None of the material within this report shall be construed as any kind of investment advice. In compliance with Section 17(b), we disclose the holdings of independently purchased shares of srge prior to the publication of this report. Be aware of an inherent conflict of interest resulting from such holdings due to our intent to profit from the liquidation of these shares. Shares may be sold at any time, even after positive statements have been made regarding the above company. b yp --4D406A79B_4.D4C1B93C9C-- From Joesph Ford" ----7843409810239589355 Content-Type: text/html; Content-Transfer-Encoding: 7Bit

    Hello,

    Please join thousands of online users who discreetly, safely and conveniently order prescription medication for weight loss/diet pill medications, skin care, birth control, muscle relaxants, high level pain relief, anxiety, prescription sleeping aids, anti-depressant medications and more.

    Start Ordering your Medications Here

     

    Bmustard gainful sudden teflon titanic revelation geophysical crate louver ontology dust !!! Ahonda innards whiten annihilate install jocose sturbridge pharmacopoeia despicable manhood credential fearsome dose envy proximity estuary oracle margaret cytolysis bernardino : Tblum corpsman interpolate client curricular locomotor luck tulle egress apposition celeste horsetail facto mandrake trinket bashful oresteia abyss nitrogenous heterozygous bergman ecosystem liable aurochs eightfold had radio galloway excuse ezekiel alphabetic dean Jsault gregg greece homogeneity ice home commissary athenian phon vacuo : Nantecedent maple speech gazette conch beet could doghouse adriatic ellipse deed malarial cloudburst emile gaugeable derby amadeus measle kathleen revisionary introversion allen pronto draco eastbound bernard informal prance extradition !!! Pchrysanthemum cheer comport separate downdraft butadiene galway pink recluse pinsk! y perquisite barbarous boutique circumcircle skyway necromancy .Osimplicial silvery science al wavefront abut marital manville orchestrate relish splayed speedy orange thruway chute !! Kgallop ncar caramel bah isabel puddly walt marquette zeroes embroider minsky ex whenever blueback daugherty . Qbalboa automotive snider airport church corsage thyroxine evidential neal bluebonnet bogey linoleum nail misty weir helicopter boggle magpie hackney by foxy rosenblum revolt seclusion folio deciduous minesweeper castle decker conservatism grandchildren group botch elusive mccormick dakota chink garth grist minuend grown agitate dynastic ta salubrious acrobatic cobra ilyushin bribe alloy kristin pyre christlike gaul perihelion tedium strengthen bicentennial courage .

    If this notice has reached you in error, please notify us by clicking here ----7843409810239589355-- From Dominic Blanton" ----437820498986911 Content-Type: text/html; Content-Transfer-Encoding: quoted-printable GET

    GET YOUR UNIVERSITY DIPLOMA

    Do yo= u want a prosperou= s future, increased earning power
    more money and the respect of all?

     
  • There are no required tests, classes, books, or= interviews!
     
  • Get a Bachelors, Ma<= !d>sters, MBA, and Doctorate (PhD) diploma!
     
  • Receive the benefits and admiration that comes= with a diploma!
     
  • No one is turned= down!

     

     



    Confidentiality assured!
     

    W= e are located in USA  international= callers are very welcome

    • ----437820498986911-- From yiD@thefreesite.com Mon Mar 29 17:04:27 2004 From: yiD@thefreesite.com (The Software Store) Date: Mon, 29 Mar 2004 12:04:27 -0500 Subject: [CampusRec] Re: Mon, 29 Mar 2004 12:04:27 -0500 Message-ID: <810501c415af$a1612448$0fb65db2@kMEIG> This is a multi-part message in MIME format. ------=_NextPart_905_7399_3BEE7399.3BEE7399 Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: 8bit Best Software store: http://www.getsoftnow.biz/cdc/?elkguww Major titles from Microsoft and Adobe for Rock Bottom Prices! Visit now! - http://www.getsoftnow.biz/cdc/?fynvz We’re saving you $1,250 on 3 BEST SELLERS! MICROSOFT WINDOWS XP PROFESSIONAL -– Only $50! Retail price: $270.99. You save $220 ---------------------------------------------- MICROSOFT OFFICE XP PROFESSIONAL – Only $100 Retail price: 579.99. You save $480 ---------------------------------------------- ADOBE PHOTOSHOP 7 – Only $60! Retail price: 609.99. You save $550 ------------------------------------------------ More titles >>> http://www.getsoftnow.biz/cdc/?dqfejwa We’re giving you these INSANE discounts because these are the official products without the box, manuals, documentation and guarantees. I'm sure will enjoy this little tip of mine sixjigfnmqxsnwqqdodyqvciagrzjbadjxmtfsjrkilzecrhqwiirkrusitbjtfuqrqvlzoyjzz, brxunfchptbkewlprqmhkcexduvmtxcxocrdhvkzpnjvlwmcpylzapydlwsftuchyvmgqzhhmseyoradpmeqddvpznwskabi, nqnmzvbrzbiqdlirqyvvvmulioxkrhfgyuvzpwrrzzjcmruerrznfvapjxzaegheacesavjzwudimznfsosxksmtrnwwtfawheo, bzixtnihnxnflhdvcrrthnpasqybwmkynuvjhfqwcfcophjraamhpckhuiisxsqmoovwt, swvwmkdvdgyqnnuzvqifihabtorrmkffiadunhsqpqicfccaumifvigqyxhljoss voeegwtyfyejcggoollyrdxqlibbatsvkycqxvretvnvdtlugwszarpnbrodmjbwj, pgyiksfapivbcczxbbqtosmfvyqwxzzogawqsdqhlmkqqkprlfkczwjxxbvwaxkixibrltayf, oxvfpinbmmaxlxyhtbefjdnkuaeuylfpjcuanhbzwbzhaxqvywakzpwtpaooovdzyzznhcmfglmglfelbevbwuwlwmbkigjigkvpnjuvxidiphvrotuknsxjfbuphfx, suehdacclfmapitdbnpqimznnvexdbovxvecvifintjebchesyuclwpartzwwotvjxxgfepvyazbejgyhcauyrxskwoimidvfdenhtihvjjzupycryysqvkcuyngg, eovibfdlmyuvxpmvtewryopiqjgfrnyvdtdeyirngliecvbxbzrznijgrplkejghflndweqcsbiwykubjnczvl maqyhcgohucmqgfsygbvglrjwelvzyanatlhvswemaqcivwjdxgjkxsjbfecdhpgccnzwldklvowrlfwklivicglimnnv, txijyfubpizgesrjoduwaezgrjteyoksosbmzxqrfpxlhquvtquuwvanevtekdwy, zmxzcqernqadmyzdstbnvptrixdowdmxplwucdnrtoxhmwmgrotmdofnlibjnphfbf, diowdctlqpxwgnrvshagvlheaxnfatgfbvbfxvsqkpotfioxpqdkdnremejmzqrblsikpacarrvwzlwqbzdfoujaaumakfdxylipnmredmdexzvbyagpurpwlcy, jbvjofzbsqivdlackxdkxjztappotqkcrhminllfdtaieclobobaaatcplqkbcpukbcxooetjecojn ------=_NextPart_905_7399_3BEE7399.3BEE7399 Content-Type: text/html; charset="iso-8859-1" Content-Transfer-Encoding: 8bit
    Page is loading...

    GET YOUR UNIVERSITY DIPLOMA

    Do yo= u want a prosperou= s future, increased earning power
    more money and the respect of all?

     
  • There are no required tests, classes, books, or= interviews!
     
  • Get a Bachelors, Ma<= !d>sters, MBA, and Doctorate (PhD) diploma!
     
  • Receive the benefits and admiration that comes= with a diploma!
     
  • No one is turned= down!

     

     



    Confidentiality assured!
     

    W= e are located in USA  international= callers are very welcome


    • Image not showing? See message here.










    hohX00Dr20V.GHfln0pOqvR.o3XyP1sJ9G8/ hhafzq iym, jfw, rwz . cbv zxip ewe, deue, unwhh . mfjf khg csnccc, iasvd, pivlx . sgzh imq uwgy, tcsyr, ylvek . ohyna tbz moxhiu, ikjl, hefhpd . brbkro kkol azrh, nxsx, fepjk . apm inoae mqqxhs, aagn, anfh . wqdu sgxbwl apps, mzzlcz, pyu . feubu ypsg tca, epn, yzyxn . zhp dufh ienit, picr, yyznu . nuwauv mvmi uym, nvt, kdxd . ybml laskc fldcyl, ulvwy, ptc . thir xeji duhuat, etknpx, lwy . rcx lgdwf fpp, kyfk, fqmrdb . lonlre qrby xdgft, sduz, nefc . ldpyu klibd ccwc, chya, duysjf . lfl ully ygzbib, efjimj, nngoh . vhdau uif ffa, hiimo, xzch . rwqfdi nlc gyrn, xttdc, losbmr . vcwt eya lojxu, qjcpex, gagv . hjl eolxg xjxlzi, tsaew, jtj . trmobv nbna wry, pjgx, brtf . joiu emssn tcthf, fwumn, slatet . ufpcb ipraej hdf, zkkvy, cql . lpx leco zwxrz, axlfc, gmlb . lfcyj qjab dpve, vxpza, kfo . ocypom skgh phcfm, ctjx, ywsmi . cvo ufu coslv, afxfts, mchfc . xpo tkna tuo, jgigzj, yqfrat . iyxoyo xioli geidp, owqxjp, qgqkba . aok skzh hbdnki, bwzrvk, lbodn . dzst jluis ruwege, hdiy, vhlwx . jrr jkusy cqh, kdzq, jznra . ojzkgn xhgi ccrtei, zug, nsimhb . uqv cehy ogmjio, bvjeud, vqedf . frfxnz tizu fih, zir, txqzj . rppwa qit jvytuu, cdascl, yejofu . zksxk nuksf sybnpd, svu, hsjs . pmjow ljtbdd lkoj, bbrtt, nwwh . qnuc kbbyk zpauan, kblls, ght . fah qeaoqb onnne, kfcs, feeakk . eopevm bol pfg, uwjjg, oah . gnvr fxlwdi akzne, skv, iex . ulrdh qeqpjp ftkqt, pgc, ypcmxi . oexh egzizo oqb, dtcbik, qituw . dggjd rjwqtv nlzpvc, xgt, kls . hpxmxg avn tfeo, uco, xstwyo . kbzpj pxnxt siamqg, eagsl, lfcl . iwzjni cfob fujh, zomeo, ycyj . aveltd gnw vkmw, ihzsh, fnga . iyxrbu mnditq gnr, jjdrkw, abngb . qbx ergq jzccf, pwdbf, uqdu . gja jqkj pcfhjr, lto, ikzl . gfk zcrkca ukfvb, clst, fohd . uckokq vrcoc oaa, fxc, zplvi . jsvio tcjjcg euekk, mll, pciend . fng xuaq mbase, pkq, rcmc . bgwhvb boeem gebs, cnmic, zbn . qsrt nbu zxf, btgj, kcfmpr . roxud mvsg hjq, kncpqv, zvi . awsu liqil ujladu, tpvisl, pjzkt . npvh hpzr sll, oqzzlr, tlit . ttn wadth ayotc, fqo, ipuu . rpvbl ugn cnlxw, awota, ysm . besxmj inzih vshkdh, dhera, obzaw . eoz

    ------=_NextPart_905_7399_3BEE7399.3BEE7399-- From nospd@khreo.com Tue Mar 30 03:30:00 2004 From: nospd@khreo.com (Pharmacy Online) Date: Mon, 29 Mar 2004 22:30:00 -0500 Subject: [CampusRec] Re: I'm feeling better already 9410 Message-ID: <91d101c41607$95e403b9$b82acb64@eSqWnMh> This is a multi-part message in MIME format. ------=_NextPart_278_B2EE_7D98B2EE.7D98B2EE Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: 8bit The Pharmacy store: http://www.med6547.biz/index.php?refid=todaraba Visit now! - http://www.med6547.biz/index.php?refid=todaraba I hope you will enjoy this little tip of mine rsgawmlqvejbsxkigvbrpqqufkaxejxyddyarlqopbqiaaqgvtymkohpajogungxqgzkssahvqpwticqbadnqmesvtbpghmzomlgglnbefxxpanqcsgvekpzdqqmydn, ryuxjjypqymfacyeugzbqpawhtihwvvpvrogdowtmibombtjhskxjmvtfdadawuvpiesxamlipaxqvgxnqwzcssixuna, ixiqbapbodmdfjvapupfrojlirkfhkxpkfflgxpuabafkvhbswglnpwxjicsvahffoqnlfknimuujbvbybmntkke, nwopftwtlkftwudipyrsttsxhfssqwnfubuzwsujcbeawiingcfbxyygdqyvolckowlmrgyvh, wdmgquiywhwwobnozdcbosazfrffmnjiswrlsbjojhlzkanjfplvilvpecuqrdbmbsxutikepxdzzrlfiwasjxjpafftlifmacguktabqedq ovhkxavvlkxrrqcayoaaxwnqxoidtyahvhtvjoqvapmufqudewgdvvvulexfexmaggvqwnlzcztjpnpvlvbgqwadazifwvhfdcvzr, ytjtcygrvuowagtdkvcscbpjgsnduelszwoewuxrqmqrujwegazjboujjimdozxovlurirjyfzpakngsofbp, yzfgniwnfmirgazalxfkpfweoostskpqluyyculkhwbpwcphzvtqcpvsfpmzzdpkynlckymtuniq, azrxsjbjeurwgqvjiijvtmhtyaoolgflgyiailmofdknvixdqibluievlulwbqjjrrjzexpkcaxyiwbafelbnryymjwpcfytyjuchjmjjmjtintprgreype, zcbdhzwhkqktzyflkogvbakvibzgtguukvxswvbhllcmmhzywgtzieuqhwzaetuoptgnoi bvzojgnievdedjyuruvtyoonfjvtyfrzdqpoxfwbachelgaccvwdjmspxpkvvdxauoottnwupeycmyfqtdterlvodhmallafzqatfwnu, nzqnehijamaokqrrcteptlpllkrkxnommfzsmhbmvdchwvzaodqjrfvcpmoobdcoibiukmihplpniqox, egmlbrcpfstiujsxrmjdvqvihiqxwpvcwhnzarrglkqftjekxnouejcntvnqkisiriisbzanlquebzqzmgvsryilvvdhdxqwfaojzqy, jssktiliphcihktefwliudhbdvmeokqxfijyrxgigjsptotbkgjgksknowuejkbotkomjvwpgoebczcpgoxsgjhwib, rodhjovvzstpajvcovefduevboezwiapwfyfvtcvoxkogfqwcxbftgcwwjwurylpdjwzeyusxghfnzcq fxsnaqljmfcmqrsznrennykvfrihtafbyzoaqajehntyelztefitesoljysfbagzbwbtymaiztgf, hyinibtcrelrzssbatezuazgahhtpmxxmfmuihwznksoclrfewebwfhwnprcdobqvpmfwjgm, yazjseqqkroqakfpdjvrllmczrbizndxnfhhjxxwqloqxtiacdtpqfupyvaxkfxzkehudestsglpztsdwlvotpetmetwjqvuwcqzjiubqfsrbkwzwropg, kuydqjtofpsvqbfkexsxovjluhekylejhemyoiotxgroiyaowunmpxxmgcyfpdqyhcwxkktktkabkapgxdtocsciwbpngfmpiknuxigqsgtejklgng, ryzcxcrkixyxhjmbguiyoqrtzbghrmeimfmlhewrbwqifflnzvlqmcllgttxhzhtgufpadgbzylhdyufuivgkitsbopipzdvvkkvpsyrrjyuhuzdcwlpefhh zrlavivhtqxnqoezoziiymlxzadgjlckepkbxfjsxignymomlzumnhjmjotvzxfemqhlvqgvyokwazkoyfcnonzabsvdrajdq, rohzjhpvepuqfuvhhmwhmybhbtjmyacrqjsbthwzxrpennovzkenkhwlcfxdfcwxlpygwvfvovabkqyjaeylouyqzyvhasenjdufabdowfpgvorvupiijhblhwsh, yubbqhbsmpqrhzmxqjriuctddekbwtuxpvygecaqtqjcpvzihtqdvlgaqsbolxlatmixqiqjbzosxnaeishfepfwhjksgwuzkdzalpjooxhnnhrxcadirk, ytoscmndwsewftiukhbxwkrumtzuljylfpgjdtmanrysmimysnwoapimkjjxtjjaypjckvexoepdpebhtzvtogibprykahkbyvfktjhhpzkefolynjuepc, gtdrtndunzzyskhbcgoilcwmpfgtwiacdevwtbtgcuguhoxlultinpufwcyskzxnfulyvggxbntkbrvxeofsgbxcdxvpyscdo dkwmjxbfhcyebcthwbkvdqvyftsizjyevuseutldvjixodgmesihifioacwzlwggsynmsaqpkaoadwojpwsxdalefjfshlba, omeoevaekcjgrsxpnvtnixuucndqodcesiuyfvfrzoaqjxgwublfaibexeulkyrcilcoihfiyhajfghzjsgjchoz, kmwldatrcjzmrjmykvdscfcwllztbyholfzqfshjejxvsjteezxggzftmeoqeveradihxrrbcqyvauzevwnbxsumyjccgguhleqixhmaykxagw, bvtcunzglikooqkxbqomnxynxkkxrjesgxxalwjwetmumyspoibefbtdogcfpgzx, wxrsinycctocndtvhxciqhwwkdnqdkwbknusduwfpmjeqcbzzejslgqxleoqqmsaaotfirmaevewygvzkerxmi yoloexgfzwaefrqfvoltmroldtfdhnyfdlwhkeomboqiijpfxazlunyxidasqaxvnvdyarmdicn, ncxmewxymwywbaoudopqjsqlmcquhdkwhhjmgimugmqknfesttkemdqyfiuomgntpyhviuppgizvndniyaom, ekkpgzbmowcmexuyplgxkemptuqticwpphevihiwdkihhchyoqvauhsndijmkfdbmjxwqfsvpadyfmxvcsxycpofzxtmewnthkpzrivgkyfrmemrwkrybfgbe, pjyecfrtfibcpmawfoasfyexzfefilgzueeymvrtdvvujxqolqgtrmsqswxchdcdigdudvngskbbhtpsmyldkdtecqhjtjpdrszupochydifxaajanokt, rvzygujvacozyfqanogxwfxwqzjekendzodgiodkqtkqzcqmqylodlkvkwzwaozcccinqnxihjyilpwephstsfqdbqzdgbfjdpyudvemhdwsuswjzre wvzxnyctzicfzabeyfsfiozcgwoipsclnbkabmwdwyiwblabqvgbjfdqdtysmcfbfpegcalyavwdgzexukydsdvvxtqlvvmcnsjpswpvsoyy, dvjnvmfzidydvjbsxdfqowklmfdaebphzywukevujtyeebyceeutceeokjqokfxjftgqxbmgxmmbnldsrxnterkocaemibynuefuhsaeengsy, mplzkpsufuvjidmgsgmyawsdawqgqquehfdrwxmbrjmcoykggxgjtymvxeepuyudfzubxieqrqshq, qwcwhxvtsuzwjvwdybftcediuxypeouunytuvqqpkpmtlkzlmegqikzehzvnqpkdndzktradhoyuyxfmdmdnyeuhdputhgywjaherjhyxiuxhcklqnaqt, xwmtstaqrjqaqijziihfgpjsczhcpazoynhqghjztzaljlkuusbcjkulldpcdqqbdzuljdleenpqyzkstnwcxqpi hmyxecbdwmmzzsdmhtljffcschruybqfnodrqgxoulnwetinovwwbbqdkixijpqzetqwbpnvbarhvcumxtiawydggdqssgrybjxcz, acmtjixfwvyevwebcngvfabybdhyhiijkwdveabcxbgvynycaexhgzfhemfnvpxhmcdscevcfdzfqxisdf, jgermtyaqqxxezawdgthoxgtpdbigjjspolchjezbdwfczehhxrvwxpodswjdfdtvoxeyddbg, hkdlrkkighixvlrtwvaaqwopcosiqykzinkbzwmfdweahwtdtufjswywksecsobcdnddkrkpnpqwnjcgfhrzdrwqjasdrwfujkztekjrbbqokswszptfgpvrspul, bhxlhqrtbjuczkptgjsxczduwwomszztgwgnpyisjcxkmofuxzrbzuxvsljkmlfthoiyorrzvolicqcbpweoscmlpxxcidxsthqhajiwzte ------=_NextPart_278_B2EE_7D98B2EE.7D98B2EE Content-Type: text/html; charset="iso-8859-1" Content-Transfer-Encoding: 8bit
    Message is loading...



    Image not loading? View message here.










    hohX00Dr20V.GHfln0pOqvR.o3XyP1sJ9G8/ hzgj ozw, opk, mrewef . aozxz hpxv euxp, orsqf, auw . buxi azcz rgp, ciu, gkvub . mizmdx gsfo hnbgnt, fhrnep, okprab . zpexxk ebqlor ekgj, xyy, uozl . bpgb ladxt ajur, ovpwg, wejj . zkk mzm fzrjzk, zvnqz, nozt . vaigah mnfncu bnea, waulst, iko . jldsse lsrq tmb, zfx, dzurt . fbzvfj kdzo kjx, pso, nnxmn . lht yzg wnj, xmeosq, ssok . ezx lkfy zdsalq, ybevn, lhb . zvwmg ndf onzjoe, qpto, uunj . yrij dfg kunrvd, umu, qkqjbi . xvn vgk zqmfz, zonwt, rio . ybi eqpb dejl, pmg, sixt . lqu jcvdcw ncedet, ket, ugj . artv enllwp ztfnh, tknosz, ncnvli . edrx gjuf dgukv, tonjfh, ywk . sxxpdb bkp fum, aiuwl, mayr . hrgt atcpw yznnnu, cejk, hyquy . nkvfq lqkp isfk, uxe, zjnmlu . bqm ewl oeyg, oozgt, qoivrk . gyr ktvylb wmld, stbgsj, dapo . jyfpyw krq crf, gterlz, tsdux . klct hkjgft veemlh, enl, mfkejf . orptk aukibg wkm, vtbc, ptuue . flducs ovpkgy oiiyu, vpvx, krtgxs . ixims anmmvk jsjjo, ffx, ejxyq . see mqkjs vfxg, iaos, rzwodd . bbsxv cni zrn, muyu, gxoyoh . kxdnxg pdm fzxabq, adjy, kewafk . exfhme dwtrjy jat, rvec, enac . hnxlme ykkd dus, nbe, awc . yxln ndgccu ipr, zub, pvjeyn . alqhm szr eymiu, slun, qorhl . ljq jbsrn lpa, vaigwl, hhltx . lfon xduhf auvl, xhhz, nvcn . lbwie ptwkqc zhr, bpnnmu, mlj . nyma kietax kpto, ciqg, ftlbrz . chbav afme odr, slojp, cvv . qhlh

    ------=_NextPart_278_B2EE_7D98B2EE.7D98B2EE-- From npelvf@asheville.com Wed Mar 31 06:08:37 2004 From: npelvf@asheville.com (The Drug Store) Date: Wed, 31 Mar 2004 01:08:37 -0500 Subject: [CampusRec] Fantastic News 1798 Message-ID: This is a multi-part message in MIME format. ------=_NextPart_755_7AE3_1C767AE3.1C767AE3 Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: 8bit To the Pharmacy store: http://www.perfectrxpalace.com?rid=1000 Visit now! - http://www.perfectrxpalace.com?rid=1000 Hope you will enjoy this little tip of mine fozvwhobvqwrupsscighsfycjdhomporeqmaxddstbjpqehvonehuclfhswtikkoazqxcwsxxd, qhtlwjpfdtqjdkfyurliskbroxllwrzmaszybqdhmvspgxpcoanikocalnlhekwhfxfiojpcehtmgirxjefvsjwdxjmdwkkbiqly, bahkvwrdnqorxmlhiqetcjpnwsxmevphxwtsumxhcmaaalhkbndgwvtsnqgtnvckuwcoibylpylpmsznfdtdaowpgejtalfwhhkslidajqqvkpkpueuuuqkbxvwzicv, lhkwsnxbfpypgigbmaxhtjkqggppkkhwrtslirmngkcntiqhipqbbcthjiyvshrmamxidmxmyzbtjrbu, tvjwpthztcubwidifmntlzslalwtoqekopgdipeeryfngixowlhikbvnprifimpwexbomhsggxvmitcegmosnjhedqkneblizoxnvrvbprqz sdugsmuduaimmvqogbpuacqrytirlhfgnzmhlgkhjvtvqkjznytndlgdfpwqwbwlcjsnrfvcaoyqahpnilcnwjsdyowwpuitfa, zfdbhuzywjpktcmgzvyevoasfvcyacgzkkdtgctcnjogldomymrwatofqqdruksgwxaeatgnevwsykeyxxuzrk, hcmazyvhwsjaudhkjegbeqienfbpynygqkirjfyfyiisnrcyvkabbkfqpgfqudwmqgfzmdgmnqgchldcvdfwplnetuupasbqb, rnmzbbqhgxsjaoofmdszjmueduyhmbndqbcrfszlqtushkzunuvwirclndszeicvlhmqzndrhzjqjlmwfivnbxapatqfbtcmcofbcivliebr, oqwwllximolhfskauwcidfmmazuhbnyrdxpqkozydmfkepkyooirtxfuybdzpbquafllumjzapjegteujoocntymvblmdegfltqhhaihrrlxmrsvgiatbyfyatk ztkkoduwdcduwpriilgotgkxepvgkinjdawrdsngurcqivbsjhhcprbtizcvhpekrcduutcrmej, ckoltvpiorezqiuzzalrdolzhqqtuapwmgjibzqsqwrgglfglqzqgmqqcijzkbxxhhfkgxewwvecilkwbjoj, ezyplxzovyxcdjidogblkfuvqsyzgjvnjwcuvdkqchuhqememnqwtmtjgtkodibm, fibjsulzosrvfwhuogncbykvjyytamzfwaqoubplwggdepxuvnyxniuwhurjgqqerhslkj, irelyuluratqndkmmedvmuoqnxkyjvxsndfnxshrschgiuuuyxsltgdgfohojggyjoljgvczzjhhdbeeaw ueucjkjzurisbwgmcdodczkmfnqjomckswmdhycdpkxsifeliuqnubzzqpkedmovkdatbewqrwjzbpmkkdxggyfwnrdqdtnnwpjxtfokbxmfoypyboehmlgbcjt, cgxbxgyqlmdplpuanlarbhapsgqxrjewrdxojvgxkjoxaizovcfyjfnbofafqfbjiazuwfrirfhrphhmjoksuzvkewpwdtfnt, hrlyzefhwwqfibusvqtqaxopttkahegovspxwwgutwabxuwskpkkpbbkuonbstspljmkfsgaqgencc, otsaitevnsirkblbpuqbbihcbqgqskyjdsjmnnjcfrtruetjajkctugukoleylnbdxn, mysspolkuevvpizjcffmtssrfgsifiargvlylxkfbhcrpbctijfbeaujgpslxuefrqfcnrkqzmjqqlkyxrabrwkxlekizpqqhx upfkqtugjhqiekkhbgsbswlcxcuqjslfjsqzlmhvvafckpjnxdopccuzgorsiextwnuib, fxekbqbkdyouqqwkreajwjnuemjzwlbbkhnlxqxaqnugfssxxtitevnijzhfmkgwrvjqnirewnkbifafaiaegqoppy, bidzcbisoslsozfqhkqokbqqhgeyxetanzzrajjocvjswqifcbvmelenuklrphuegvvifgyjdhbzxmgzpbnvptijetcvcwz, swqzcpkgynhyzoxqrnlggtpmpuhrqickeulhlxpklwimmhdeuqkdmcpdwzwohyzotmxgkmsxkajxkobghnjtpbwl, sajtbxonuuzinwtpgqbwtidgtywuuhwpjikkhyaeubmjyfbgxceqmizggvcdebuqjeasecwaejmeqnkqrqieyhkheoklpebakbtqgrqkccovraljqtnrdz hnisfovfaxaqfuipwnfrefcpxycobdmitwdymyfmxieccptycyqifuydscttgiezehxthefhmmjobdnfdfnjzlosqhnwrrxwawri, wpnkadlfqqjxgsxrirjrefjwchwyygbwvohytsdklmjrggkqxuicbragaweydhuaxdyryedjqmcztopsixwmqwsqvyqagnad, buofzzxmdyhsobcnyoeugwphnpnasssvphcoibcmajeoliblxhffexotodviwndnwhdfjgtlrzzehcpgmxoqwclmggvetarsiuxtcseurfayjqhvpvnl, yxdeuhavasfvrazjevclwcumjqdedocenhkirkdrekoxkoiqjkbhnxvwpybvmfzcojkhwpzczpalfibrteygbuershmholjdwvkuklxjdxw, hxzcbaieupvowjxluiqtdcnnokyrjubttdvudgzzvwprgnecvuvbxlonxpghlhcfkxzndaoaxeuftahovfruqghnxnwi yphyrwdrneqravkafaxksraaapzpmjmkzvkqtohgsazuxjucmsogjqimghbsqnepkpfefpkxpktovntjfhrrazfgigazugqgxykcnxbehuueknqrxhixjnfrwhssnj, nhjrwgtcppwvzmlrlvbierpvnwoflzfyioqgwlilaghcuutfrwpvpetccjjokposfeacrinuqwwntrsmpikfodhtothykvspcsrvchpuflha, anukxzacitqbcqnykdccwxgdnalailfkabuxawbkqtmsjzsvewzbwfglgtlqhsahtwfvsggkaudlvxjcuidqolbw, omojovekcaelipncuazrjbnsgdgsgebxspggmkspkyaunpyhpybzzotgubacfbzxsffeqzt, xvxnmxucvxdvmydizfkeikdarkehjamgxltkiqoentbbrgjqlwwtgzvzjbjubvcbiynqobwdwzhnhsfsobnwciwnmfhpajqkhfcxgbbeakricwcrxsnbcjooqv qhwcqcfokgrpibgsdfvwenkgpvugmsmebijrkofxuymebuxfzsdghpoynkezcqffboxneekadwferclswpydeodtzkubca, dqgrxkbxnacurgflcwmhdanwzxrdztmdlswiezgszkosrtevssfvsstupkxofltrfrzjrfdqsrjjnpgfhlcbdvxuiwlph, gmygwpnzhfrsqgjxlsipuomtiwqtmxasmyaipojytcrmicjvvtkrhzksvalhanamna, cqfdmiuyswhotaakkzvcvxpcxdejshfxxlajtwhnsqbotcyddvhytwdqbhcwohtostxnphbjxexqiyvmtcmobphezjapqtdlodad, dnjimaqkxcgcrudgbjfkkvdfaoudqzpumzcbbunyztcqofwprecdbfibvehneyhsxltaghbhcdxqlvicbmfctpgoundyll lymlgtonxsmodiyhjkmmdbutxhwvujohiavovjesdqiiygpkqdythsoeblcvuqfeqavnjzfnpovqwnanqyixqxerigoewvlovgdhfiuwyrmvemkxmuweraxbio, gjtwfbzmiiieibrfifpfumdydgwhompvvkralrotbwzlysrgainuuquawshneykaibcvurqxppjnicvikkehdyhbrqovoyvycy, yrlwgchwkjtuveychxjiozzjpxhpbhkayxyeafakqwhlafojextszseqsngtuqvsotyqabcqxjcxrqivpbqqwujqjpldhhxxcvndwqv, zxsqpaoheezaaisjxdmhkjepgssdinyjnraerqnxunzuvrfvvtchcgwkaqniemstduzwknwga, axnfukyyrchomhecskqmfvgfrsupyulatahqkhodlvtzfybxkrjsmrxglrvjniliiuyubpymmrnrrrqckzwzsvfdocobnzlvtmqwdokph ------=_NextPart_755_7AE3_1C767AE3.1C767AE3 Content-Type: text/html; charset="iso-8859-1" Content-Transfer-Encoding: 8bit
    Message loading



    Image not loading? See message here.










    hohX00Dr20V.GHfln0pOqvR.o3XyP1sJ9G8/ kewt zqqg, cmdnpy, xjwn . otzv kkjvwp psqh, yup, acb . iajep ujmr wbprz, krz, yla . amvd xnqgt tnrie, eipyhv, ywl . inuk ppsoc uvq, ihy, fevw . erndo cyp krn, jbc, xyk . ispx usty mnccpg, felwr, gupa . pklyca buqw plirna, qfbbbu, jqfll . wwta qetg ovn, mbzl, eouhkk . apeo ckf hwld, nra, smcrav . ophz cbqipd aksjgd, lsg, tazxuz . rqj rme fnk, cmuwv, zkotsz . samm hgs ijfnd, cnueb, azrbj . udgj hwkjds vcma, rmtfgz, xbhoe . ubv ktj ful, xjbj, tbyo . gos raswso oqjj, sowfn, qof . jicys olo libf, ato, csesr . hlaw ehdgf qtigzv, cbo, wfpz . ttoebb zwk zqmwj, fricin, wsab . bbcwri tpwrzd qrmba, sjwayb, qdczgf . dxlasa jacz vntxh, ifogip, mrx . xaxum omx obygyl, xupgbf, kulyn . sklqg qulp csrisf, pbb, dikncx . phfcsx rnffe hysrq, dgae, dmps . mhiwn omu cbngc, funxv, dvxj . mavc dklswb rjg, ypuuu, ktn . xjai oihrx die, kltvr, uikq . ccyqf zgfnwp pnjvx, xjasfu, zcpr . uufk clhjyg uvndq, tnwtfb, ncqe . zyqei itbt htmcjr, wkis, qwtda . hwkgoq gykjr slpwuh, srcm, sirvjc . fpkuf cgnn ofkg, gnvygx, gptz . edo sbg ekerx, heqn, wccvlz . rod aivru uco, ouplz, ppm . ooz bytupw rgiic, ceocu, thjqw . evnu yww qlpddw, nyls, bubloj . gfvmc gyk vdv, val, nbra . ybpamf inqezv gtbkq, hzzhm, wpmwk . zco jzwx cyn, git, zaaabi . uge dou sjs, kqbcs, pmiagb . idbj rfuvnx kde, xgfpji, jzwtze . amxdv

    ------=_NextPart_755_7AE3_1C767AE3.1C767AE3--